DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and fab1

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:NP_596090.2 Gene:fab1 / 2541154 PomBaseID:SPBC3E7.01 Length:1932 Species:Schizosaccharomyces pombe


Alignment Length:110 Identity:35/110 - (31%)
Similarity:58/110 - (52%) Gaps:1/110 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   855 TPSSASSTSSSSEQNSPVSARSGSRRRLQSNNETQMPSSATSTSATLSPPAWIPDGKAPRCMACQ 919
            ||::||.|......:...:..:.|..::..::|..:.::....::|||...|:.|.:...|..|:
pombe     6 TPTAASPTFPVETSHRLDTLHTSSTEQIIKDSENVVHTTLKLPTSTLSREFWMKDERTNNCSLCE 70

  Fly   920 TPFTAFRRRHHCRNCGGVFCGVCSNASAPLPKYGLTKAVRVCRDC 964
            |.||.|||:||||.||.:.|..|.. .||...:.|..:::|||.|
pombe    71 TEFTLFRRKHHCRICGKIICKYCLK-EAPGFIFRLQGSIKVCRPC 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270 26/63 (41%)
fab1NP_596090.2 FYVE 54..120 CDD:214499 25/62 (40%)
Fab1_TCP 477..738 CDD:239450
MSS4 1322..1932 CDD:227578
PIPKc 1599..1917 CDD:238081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2108
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.