DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and SPBC9B6.03

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:NP_595745.1 Gene:SPBC9B6.03 / 2540208 PomBaseID:SPBC9B6.03 Length:293 Species:Schizosaccharomyces pombe


Alignment Length:194 Identity:50/194 - (25%)
Similarity:78/194 - (40%) Gaps:40/194 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   789 GEGSPSGATTATSRSHVTRSRSLGDQEAASSATSSTAQLRQLEQQQQQQQLQIQLQRQRNNSVGS 853
            |.||.||:..::|.|......||.........:|.|.:.|.            :|.|..:.:...
pombe    46 GTGSVSGSPNSSSNSTPANQGSLPSHTNPQLYSSITRKERP------------ELFRSYSGNPRL 98

  Fly   854 NTPSSASSTSSSSEQNSPVSARSGSRRRLQSNNETQMPSSATSTSAT-----------LSPPAWI 907
            :.|.::|..::||...|           .|:.:.:..|:|..|:.||           :|...|.
pombe    99 SKPYASSKLAASSRTAS-----------YQAMSYSVSPTSTNSSVATSLNYQSSRETGISKDHWK 152

  Fly   908 PDGKAPRCM--ACQTPFTAFRRRHHCRNCGGVFCGVCSNASAPLP---KYGLTKAV-RVCRDCY 965
            ||.....|.  :|...|..|.||||||.||.:||.:..:.:.||.   |:.|..:: |.|..|:
pombe   153 PDSDVSVCSFPSCSVRFGLFDRRHHCRRCGDIFCALHCDRNIPLTMDVKFCLAGSLYRSCVSCF 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270 25/70 (36%)
SPBC9B6.03NP_595745.1 FYVE_scVPS27p_Vac1p_like 159..216 CDD:277275 20/56 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2108
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.