DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and Rundc3b

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:NP_001334240.1 Gene:Rundc3b / 242819 MGIID:2685286 Length:457 Species:Mus musculus


Alignment Length:336 Identity:57/336 - (16%)
Similarity:109/336 - (32%) Gaps:102/336 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 EELLGEDRDPRAFRAKFPEEVLQENLAGQL------WFGAECLAAGSSIMNRETESKEMRPLAQA 129
            :.:..::.:.|.|.:...|....||:...|      ||. :|              |.:|...|.
Mouse   213 DSISSDEEELRTFGSSDSESSTPENVGPPLILDENTWFN-KC--------------KRVRQKYQL 262

  Fly   130 VTKSLGNVRVL--LRDQCLKNNVPNSKTLHLDLNDSTTEQLYESLKIFDRLFAEFELSYVSAMVQ 192
            ..:..|.:..|  ||:..|..:|..:|.|...:.||......|          :.:|.|:..   
Mouse   263 TLEQKGYLEELLRLRENQLSESVSQNKILLQRIEDSDLAHKLE----------KEQLEYIIV--- 314

  Fly   193 VKSRHEYEMQQWIGVLFSETLQRALKIGLLDQEMVDAFDPGLMFSIPRLAIVAGLVVYAKGPLNM 257
                   |:|..:.||.:..|:                        .|..:.|.|......|..:
Mouse   315 -------ELQDQLTVLKNNDLR------------------------SRQELTAHLTKQWPSPGAL 348

  Fly   258 DMPGDQLSEMFRPFRTILIKIRDLLRNLNNQELYQLEKLLCTNEDINTKVPLGSSSIEAPSPEHS 322
            |:..              :.:..||...:|::.|  :|...:.:.::.:|.|..:|::   |.| 
Mouse   349 DVNA--------------VALDTLLYRKHNKQWY--DKSYQSLDQLSAEVSLSQASLD---PSH- 393

  Fly   323 SHPTTSSSQNNNNSSNNNHSSSSTNTTSTTTTTAGTTNTHRTVERLVDQRNNNHNSNSNSSTNPT 387
                  |.:.:....:.|........|.:.....|:..:..:.:.|...::|      :...:||
Mouse   394 ------SQEGDGKQDSLNFIGEGKEDTPSLLGLCGSLTSVASYKSLTSLKSN------DCLASPT 446

  Fly   388 VEAATLRSPSM 398
            .|   |.||.:
Mouse   447 TE---LTSPGL 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270
Rundc3bNP_001334240.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839960
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.