DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and Rufy1

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:NP_766145.1 Gene:Rufy1 / 216724 MGIID:2429762 Length:712 Species:Mus musculus


Alignment Length:392 Identity:95/392 - (24%)
Similarity:152/392 - (38%) Gaps:89/392 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   617 CSLEAADPERIQPDREQNLASGDTSAASSLSDDVSLAMRNTTARLK-FKSTENLLHRLFVCIAGV 680
            |||:    :..|..||||....:.|..|     |.:..::|...|: :|.|...|..::      
Mouse   355 CSLQ----KEQQQLREQNEVIRERSEKS-----VEITKQDTKVELETYKQTRQGLDEMY------ 404

  Fly   681 ADQLQTNFASDLRQILRSVFLMNMSTAQE-EIDIPEKTKESELFEFRASENDVIQES---AGSNQ 741
                     ||:.:.|:....:.:...:| |:.|..|| |.|: ..:..|.|..::.   ....|
Mouse   405 ---------SDVWKQLKEEKKVRLELEKELELQIGMKT-EMEI-AMKLLEKDTHEKQDTLVALRQ 458

  Fly   742 SIYSAEEVNPEL-DNVFSAGGGNQATGQRHSAGASMQRNNTIDLASQPG-----EGSPSGATTAT 800
            .:...:.:|.:: ..|.||....|   |::.|.||.:...|..::|...     :.:......|.
Mouse   459 QLEEVKAINLQMFHKVQSAESSLQ---QKNEAIASFEGKTTQVMSSMKQMEERLQQAERARQAAE 520

  Fly   801 SRSHVTRSRSLGDQEAASSATSSTAQLRQLEQQ------------QQQQQLQIQLQRQRNNSVGS 853
            .|||..:      ||.:...::...||.||..|            :|:|.||.:|||:::.|...
Mouse   521 ERSHKLQ------QELSGRGSALQLQLSQLRDQCSGLEKELKSEKEQRQALQRELQREKDTSCLL 579

  Fly   854 NT----------------PSSASSTSSSSEQNSPVSAR----SGSRRRLQSNNETQMPSSATSTS 898
            .|                ...|.......||...:...    |.|:.:::...|         .:
Mouse   580 QTELQQVEGLKKELRELQDEKAELRKVCEEQEQALQEMGLHLSQSKLKMEDIKE---------VN 635

  Fly   899 ATLSPPAWIPDGKAPRCMACQTPFTAFRRRHHCRNCGGVFCGVCSNASAPLPKYGLTKAVRVCRD 963
            ..|....|:.|.:|..|..|:..|:..||:|||||||.:||..||:....||.|  .|.||||..
Mouse   636 KALKGHTWLKDDEATHCKQCEKDFSISRRKHHCRNCGHIFCNTCSSNELALPSY--PKPVRVCDS 698

  Fly   964 CY 965
            |:
Mouse   699 CH 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270 28/64 (44%)
Rufy1NP_766145.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
RUN 151..274 CDD:280855
DUF3422 <444..589 CDD:295160 33/153 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..532 7/39 (18%)
Interaction with RAB4. /evidence=ECO:0000269|PubMed:11172003 619..629 2/9 (22%)
FYVE_RUFY1 638..708 CDD:277297 29/65 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839943
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.