DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and PIKFYVE

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:XP_011509080.1 Gene:PIKFYVE / 200576 HGNCID:23785 Length:2110 Species:Homo sapiens


Alignment Length:217 Identity:56/217 - (25%)
Similarity:74/217 - (34%) Gaps:65/217 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   800 TSRSHVTRSRSL---GDQEAASSATSSTAQLRQLEQQQQQQQLQIQLQRQRNNSVGSNTPSSASS 861
            ||.||:|..:.|   .|:....||.||...|.:..:::.:            ...|...|.|.|.
Human    22 TSPSHLTHFKPLTPDQDEPPFKSAYSSFVNLFRFNKERAE------------GGQGEQQPLSGSW 74

  Fly   862 TSSSSEQNSPVSARSGSRRRLQSNNETQMPSSATSTSATLSPPA--------------------- 905
            ||......:. |.||.:..:.|.|.|.|..|||.:.::...|..                     
Human    75 TSPQLPSRTQ-SVRSPTPYKKQLNEELQRRSSALADNSLQHPQENTDTRRKAEPTFGGHDPRTAV 138

  Fly   906 ----------------------------WIPDGKAPRCMACQTPFTAFRRRHHCRNCGGVFCGVC 942
                                        |:||.:...|..|...||.||||||||.||.:||..|
Human   139 QLRSLSTVLKRLKEIMEGKSQDSDLKQYWMPDSQCKECYDCSEKFTTFRRRHHCRLCGQIFCSRC 203

  Fly   943 SNASAPLPKYGLTKAVRVCRDC 964
            .|...|....|.|..:|.|..|
Human   204 CNQEIPGKFMGYTGDLRACTYC 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270 28/112 (25%)
PIKFYVEXP_011509080.1 FYVE_PIKfyve_Fab1 166..227 CDD:277264 27/60 (45%)
DEP_PIKfyve 369..450 CDD:239895
Fab1_TCP 629..889 CDD:239450
PIPKc 1784..2097 CDD:238081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2108
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.