DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and RUNDC3B

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:NP_612147.1 Gene:RUNDC3B / 154661 HGNCID:30286 Length:473 Species:Homo sapiens


Alignment Length:483 Identity:102/483 - (21%)
Similarity:167/483 - (34%) Gaps:100/483 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KSLLARFFHAD-RSLTAVASELDSFDGRAEPDR-CTRLVSRLRQNQDKVLAITNLIMEELLGEDR 78
            |||.||....: |:|..|.    .|..:...|| |...:.......:...||...|:...|.|..
Human    22 KSLSARNAAVERRNLITVC----RFSVKTLIDRSCFETIDDSSPEFNNFAAILEQILSHRLKEIS 82

  Fly    79 DPRAFRAKFPEEVLQENLAGQL-WFGAEC---------LAAGSSIMNRETESKEMRPLAQAVTKS 133
            ....:.|.     ||..|.||: |||.|.         :|......|.....:.|..::.:..|.
Human    83 QSCRWLAH-----LQIPLQGQVTWFGYESPRSFWDYIRVACRKVSQNCICSIENMENVSSSRAKG 142

  Fly   134 LGNVRVLLRDQCLKNNVPNSKTLHLDLND-STTEQLYE------------------SLKIFDRLF 179
            ...:||.|.::.|      |:.:...|.| .||.:.||                  .|...|..|
Human   143 RAWIRVALMEKHL------SEYISTALRDFKTTRRFYEDGAIVLGEEANMLAGMLLGLNAIDFSF 201

  Fly   180 --------AEFE--------LSYVSAMVQVKSRHEYEMQQWIGVLFSETLQRALKIG---LLDQE 225
                    ..|.        |.|:.:...:.|..| |::. :|...||: .....:|   |:|:.
Human   202 CLKGEGLDGSFPAVIDYTPYLKYIQSSDSISSDEE-ELRT-LGSSGSES-STPENVGPPFLMDEN 263

  Fly   226 MVDAFDPGLMFSIPRLAIVAGLVVYAKGPLN--MDMPGDQLSEMFRPFRTILIKIR--DLLRNLN 286
                   .......|:.....|.:..||.|.  :.:..:||||.....:.:|.:|.  ||...|.
Human   264 -------SWFNKCKRVKQKYQLTLEQKGYLEELLRLRENQLSESVSQNKILLQRIEDSDLAHKLE 321

  Fly   287 NQEL-YQLEKL-----LCTNEDINTKVPLGSS-SIEAPSP---EHSSHPTTSSSQNNNNSSNNNH 341
            .::| |.:.:|     :..|.|:.::..|.:. :.:.|||   :.::....:.....:|......
Human   322 KEQLEYIIVELQDQLTVLKNNDLRSRQELTAHLTNQWPSPGALDVNAVALDTLLYRKHNKQWYEK 386

  Fly   342 SSSSTNTTSTTTTTAGTTNTHRTVERLVDQRNNNHNSNSNSSTNPTVEAATLRSPSMLSLSATST 406
            |..|.:..|...:.:.|:         :|...:........:.|...|... .:||:|.|..:.|
Human   387 SYQSLDQLSAEVSLSQTS---------LDPGQSQEGDGKQDTLNVMSEGKE-DTPSLLGLCGSLT 441

  Fly   407 PTASPAPSPTPSHSIASTSSAATSSTNP 434
            ..|| ..|.|...|....:|..|..|:|
Human   442 SVAS-YKSLTSLKSNDYLASPTTEMTSP 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270
RUNDC3BNP_612147.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 1/1 (100%)
RUN 65..203 CDD:397055 33/148 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..428 4/37 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149916
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.