DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and RUNDC3A

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:XP_016879524.1 Gene:RUNDC3A / 10900 HGNCID:16984 Length:474 Species:Homo sapiens


Alignment Length:450 Identity:89/450 - (19%)
Similarity:159/450 - (35%) Gaps:124/450 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IMEELLGEDRDPRAFRAKFPEEVLQENLAGQL-WFGAE--------CLAAGSSIMNRETESKE-M 123
            |:|::|.     ..|:|..|        ||.: ||.::        ...|.|.:.|....|.| |
Human    64 ILEQILS-----HRFKACAP--------AGPVSWFSSDGQRGFWDYIRLACSKVPNNCVSSIENM 115

  Fly   124 RPLAQAVTKSLGNVRVLLRDQCLKNNVPNSKTLHLDLNDS-TTEQLYESLKIFDRLFAEFELSYV 187
            ..::.|..|....:||.|.::.:...:..:      |.|: ||.:.|:|..|..|    .|.:.:
Human   116 ENISTARAKGRAWIRVALMEKRMSEYITTA------LRDTRTTRRFYDSGAIMLR----DEATIL 170

  Fly   188 SAMVQVKSRHEYEMQQWIGVLFSETLQRALKIGLLDQE--MVDAFDPGLMFS------------- 237
            :.|:...|..::..              .||..:||.:  :|..:.|.|.|:             
Human   171 TGMLIGLSAIDFSF--------------CLKGEVLDGKTPVVIDYTPYLKFTQSYDYLTDEEERH 221

  Fly   238 -------------IPRLAIVAG---------------LVVYA-KGPLN--MDMPGDQLSEMFRPF 271
                         .|.|.:|..               .:||| ||.|.  :.:...||.::....
Human   222 SAESSTSEDNSPEHPYLPLVTDEDSWYSKWHKMEQKFRIVYAQKGYLEELVRLRESQLKDLEAEN 286

  Fly   272 RTILIKIRDLLRNLNNQELYQLEKLLCTNEDINT------KVPLGSSSIEAPSPEHSSHPTTSSS 330
            |.:.:::.:.... |.:|..:||.::...::..|      ..||...|.|..:|..:..|:..:.
Human   287 RRLQLQLEEAAAQ-NQREKRELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTL 350

  Fly   331 QNNNNSSNN----NHSSSSTNTTSTTTTTAGTTNTHRTVERLVDQRNNNHNSNS---------NS 382
            .....:||:    .||..||...|...:.  ::::.|..|...|:.........         .|
Human   351 NGAEGASNSKLYRRHSFMSTEPLSAEASL--SSDSQRLGEGTRDEEPWGPIETEFRQAGLELLTS 413

  Fly   383 STNPTVEAATL------RSPSMLSL--SATSTPTASPAPSPTPSHSIASTSSAATSSTNP 434
            |.:||:.:.:.      .:||||.|  |..|.|:.....|...:..:.|.|...:.:.:|
Human   414 SDSPTLASQSAGITGKDPTPSMLGLCGSLASIPSCKSLASFKSNECLVSDSPEGSPALSP 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270
RUNDC3AXP_016879524.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149919
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.