DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and zfyve1

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:XP_001344703.1 Gene:zfyve1 / 100005732 ZFINID:ZDB-GENE-131205-1 Length:779 Species:Danio rerio


Alignment Length:111 Identity:34/111 - (30%)
Similarity:47/111 - (42%) Gaps:22/111 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   877 GSRRRLQSNNETQM-------------------PSSATSTSAT--LSPPAWIPDGKAPRCMACQT 920
            ||.:.|:.||....                   |:.|.:...|  ::|..|.|:....||..|..
Zfish   546 GSDKFLKDNNNAAQRLLDGVNFMAQSVSELSVKPAKAVTAWLTDQIAPAYWKPNSLILRCYKCGA 610

  Fly   921 PFTAFRRRHHCRNCGGVFCGVCSNASAPLPKYGLTKA-VRVCRDCY 965
            .|.....:||||.||..||..||:.:.|:|:.|...| ||||..|:
Zfish   611 GFEDNDTKHHCRACGEGFCDGCSSKTRPVPERGWGLAPVRVCDACF 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270 26/65 (40%)
zfyve1XP_001344703.1 GBP 175..411 CDD:206650
PHD_SF 595..656 CDD:304600 24/60 (40%)
FYVE_ZFYV1 713..773 CDD:277273
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584069
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.