DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and SWF1

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_010411.1 Gene:SWF1 / 851704 SGDID:S000002533 Length:336 Species:Saccharomyces cerevisiae


Alignment Length:331 Identity:77/331 - (23%)
Similarity:107/331 - (32%) Gaps:152/331 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VCLTPIF---W-FVDNYTHCLGPFFVVGVAALTTSVVSIAYWIGLPFWWAKSQLVTYFLLIVGNW 106
            :.|:|:|   | |...|.:...||.|                ....:.| |..||..|...:   
Yeast    17 ILLSPVFKSTWPFSTFYRNVFQPFLV----------------DDQKYRW-KLHLVPLFYTSI--- 61

  Fly   107 LLLNVVFHYVMAVITPAGH----------------PPEGVSLVEAVS------------------ 137
             .|.:|:.|.|.|.:...:                ||..:.::..||                  
Yeast    62 -YLYLVYTYHMRVESTIKNELFLLERILIVPIIILPPVALGILAMVSRAEDSKDHKSGSTEEYPY 125

  Fly   138 ---------MCGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNHRYFFLY-------- 185
                     .|..|...||.|:.||||||||:|..||||.|:|||:|.||:..|:|:        
Yeast   126 DYLLYYPAIKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSM 190

  Fly   186 ----------------------MTYTTL-GCLFLI--LF----------GLEIGHKYLWL----- 210
                                  :|.|.| ||..:|  :|          |:....:..|.     
Yeast   191 CYAFLRLWYISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEY 255

  Fly   211 -----------DHGENW----TE-----IEPLEGQPVKF-----------NLSGHIIPVTH---- 240
                       |...:|    ||     .|||:.|.|.|           ||: |.|.:..    
Yeast   256 MREGKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNLT-HYITIKDASEI 319

  Fly   241 PNEYDE 246
            ||.||:
Yeast   320 PNIYDK 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 34/104 (33%)
SWF1NP_010411.1 COG5273 22..336 CDD:227598 75/326 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2852
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.