DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and AT5G04270

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_196047.3 Gene:AT5G04270 / 830306 AraportID:AT5G04270 Length:271 Species:Arabidopsis thaliana


Alignment Length:323 Identity:85/323 - (26%)
Similarity:137/323 - (42%) Gaps:83/323 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 VVGVAALTTSVVSIAYWIGLPFWWAKSQLVTYFLLIVGNWLLLNVVFHYVMAVI-----TPAGHP 126
            |:|.....|..|.|..|:||.....|...:.:.||..   |.|   |...:.|:     .||.:.
plant    17 VMGFVYYVTLFVFIDDWVGLQSSAGKLNALLFSLLAS---LCL---FSLSICVLVDPGRVPASYA 75

  Fly   127 PE------GVSLVEAVSMCGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNHRYFFLY 185
            |:      ..|.|.....|.||.|.||.|||||.:|.||:|||||||.|:||||||.|::.||:.
plant    76 PDVEDSGWSNSNVTETRKCDKCFAYKPLRTHHCRVCRRCVLKMDHHCLWINNCVGYANYKAFFIL 140

  Fly   186 MTYTTLGCLFLILFGLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSGHIIPVTHPNEYDEFVLP 250
            :.|.|:..::..:..:....|     :|:::....||:                      .|::.
plant   141 VFYATVASIYSTVLLVCCAFK-----NGDSYAGNVPLK----------------------TFIVS 178

  Fly   251 PAVHNLPTPIVDTDAASPGRRRALWFMAFTNVAVVLALGSLSIWHAKLITRGETSVEAHINEAER 315
            ..:                      ||    :.:.:.||:|..||..|||...|::|.:  :::|
plant   179 CGI----------------------FM----IGLSITLGTLLCWHIYLITHNMTTIEHY--DSKR 215

  Fly   316 KRHLQQQ--RIYINPYNFGTKKNWKLFLG--LVRGRSFWRTVLLPSWHKPEGTGLSFHTVNDA 374
            ...|.::  :.|.:.::.|..||....||  :::    |   |.|::.:....|:||....|:
plant   216 ASWLARKSGQSYRHQFDVGFYKNLTSVLGPNMIK----W---LCPTFTRNPEDGISFSASRDS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 33/61 (54%)
AT5G04270NP_196047.3 DHHC 90..211 CDD:396215 50/173 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1946
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1931
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.