DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and AT4G22750

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_567668.1 Gene:AT4G22750 / 828372 AraportID:AT4G22750 Length:302 Species:Arabidopsis thaliana


Alignment Length:394 Identity:103/394 - (26%)
Similarity:145/394 - (36%) Gaps:133/394 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LRWSYMKHCWHSLTFNAHMNSSYASDVCLTPIFWFVDNYTHCLGPFFVVGVAALTTSVVSIAYWI 84
            :.|:..|.|.......:.|.......:..|.....|.||    ||..::|......||:.:|:: 
plant     1 MAWNVFKFCTALRALGSIMILIVIGIIGFTYYAVVVVNY----GPALLIGGVDSLLSVLVLAFF- 60

  Fly    85 GLPFWWAKSQLVTYFLLIVGNWLLLNVVFHYVMAVITPAGHP----PE----------------- 128
                         :||||:..|...:||      |..|.|.|    ||                 
plant    61 -------------HFLLIMLLWSYFSVV------VTDPGGVPTGWRPELDIEKSEGNQALIGEAS 106

  Fly   129 -GVSLVEAVSMCGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNHRYFFLYMTYTTLG 192
             |.|....|..|.||...||||:||||:|.||||||||||.|:.||||..|::.|.|::.||.|.
plant   107 VGDSSSHGVRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGANNYKSFLLFLFYTFLE 171

  Fly   193 C---------LFLILFGLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSGHIIPVTHPNEYDEFV 248
            .         :||:.|.                      :|       .|.|             
plant   172 TTVVAVSLLPIFLVFFS----------------------DG-------DGDI------------- 194

  Fly   249 LPPAVHNLPTPIVDTDAASPGRRRALWFMAFT-NVAVVLALGSLSIWHAKLITRGETSVEAHINE 312
                            ..|||...|. |:||. |:|..|::....|.|..|:.|..|::||:   
plant   195 ----------------TVSPGSLAAS-FVAFVLNIAFALSVLGFLIMHIMLVARNTTTIEAY--- 239

  Fly   313 AERKRHLQQQRIYIN-PYNFGTKKNWKLFLGLVRGRSFWRTVLLPSWHK---PEGTGLSFHTVND 373
               ::|.      :| |||.|.|.|::...|  ..:.:|...|.....|   |...||.|.:.::
plant   240 ---EKHT------VNWPYNVGRKTNFEQVFG--SDKMYWFVPLYTEDDKKKLPALGGLDFTSRSE 293

  Fly   374 APFE 377
            :..|
plant   294 SETE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 36/70 (51%)
AT4G22750NP_567668.1 zf-DHHC 111..241 CDD:279823 57/194 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55511
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.