DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and AT3G09320

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_566348.1 Gene:AT3G09320 / 820088 AraportID:AT3G09320 Length:286 Species:Arabidopsis thaliana


Alignment Length:330 Identity:83/330 - (25%)
Similarity:133/330 - (40%) Gaps:115/330 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 VTYFLLIVG------------NW-----------------LLLNVVFHYVMAVITPAGHPP---- 127
            ||..:|::|            .|                 |.|..:::|.:||....|..|    
plant    12 VTVVMLVIGFIYFASVFTFIDRWFSLTSSPGIANAAAFTALALMCIYNYSIAVFRDPGRVPLNYM 76

  Fly   128 ----EGVSLVEAVS-------MCGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNHRY 181
                :..|.|..:.       .|.||...||||.|||.:|.||:|:|||||.|:|||||:.|::.
plant    77 PDVEDPESPVHEIKRKGGDLRYCQKCSHFKPPRAHHCRVCKRCVLRMDHHCIWINNCVGHTNYKV 141

  Fly   182 FFLYMTYTTLGCLFLILFGLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSGHIIPVTHPNEYDE 246
            ||:::.|....|::.::  |.:|.           ..:||.:.:                .|...
plant   142 FFVFVVYAVTACVYSLV--LLVGS-----------LTVEPQDEE----------------EEMGS 177

  Fly   247 FVLPPAVHNLPTPIVDTDAASPGRRRALWFM-AFTNVAVVLALGSLSIWHAKLITRGETSVEAHI 310
            ::                       |.::.: ||..:.:.:|||.|..||..||.:.:|::|.| 
plant   178 YL-----------------------RTIYVISAFLLIPLSIALGVLLGWHIYLILQNKTTIEYH- 218

  Fly   311 NEAERKRHLQQQ--RIYINPYNFGTKKNWKLFLGLVRGRSFWRTVLLPSWHKPE----GTGLSFH 369
             |..|...|.::  ::|.:||:.|..:|..|.||        ..:|  ||..|.    |:|:.|.
plant   219 -EGVRAMWLAEKGGQVYKHPYDIGAYENLTLILG--------PNIL--SWLCPTSRHIGSGVRFR 272

  Fly   370 TVNDA 374
            |..|:
plant   273 TAFDS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 30/61 (49%)
AT3G09320NP_566348.1 DHHC 94..217 CDD:396215 47/174 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1931
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.830

Return to query results.
Submit another query.