DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and ZDHHC14

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_016866796.1 Gene:ZDHHC14 / 79683 HGNCID:20341 Length:506 Species:Homo sapiens


Alignment Length:318 Identity:67/318 - (21%)
Similarity:111/318 - (34%) Gaps:114/318 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 FVVGVAALT------TSVVSIAYWI------GLPFWWAKSQLVTYFLLIVGNWLLLNVVFHYVMA 118
            |.||..||.      :.:.:|:.|:      ..|:...|   :|..:..|.     .::|.:||.
Human    69 FCVGSRALPWGQRGWSCLPTISSWLAGCLLRSCPYLAVK---ITPAIPAVA-----GILFFFVMG 125

  Fly   119 V----------ITPAGHPPEGVSLVEAVSM-----------------------------CGKCIA 144
            .          :.|...|.|...|...:.:                             |..|..
Human   126 TLLRTSFSDPGVLPRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVIINGQTVKLKYCFTCKI 190

  Fly   145 PKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNHRYFFLYMTYTTLGCLFLILFGLEIGHKYLW 209
            .:|||..|||:|:.|:.:.||||||:.||||..|:|:|  ||...:|..|.:.:|...|.|..| 
Human   191 FRPPRASHCSLCDNCVERFDHHCPWVGNCVGKRNYRFF--YMFILSLSFLTVFIFAFVITHVIL- 252

  Fly   210 LDHGENWTEIEPLEGQPVKFNLSGHIIPVTHPNEYDEFVLPPAVHNLPTPIVDTDAASPGRRRAL 274
                              :...:|.:               .|:.:.|..:::.         .:
Human   253 ------------------RSQQTGFL---------------NALKDSPASVLEA---------VV 275

  Fly   275 WFMAFTNVAVVLALGSLSIWHAKLITRGETSVEAHINEAERKRHLQQQRIYINPYNFG 332
            .|.:      |.::..||.:|..||:..:|:.|........||..:.    .|||::|
Human   276 CFFS------VWSIVGLSGFHTYLISSNQTTNEDIKGSWSNKRGKEN----YNPYSYG 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 28/61 (46%)
ZDHHC14XP_016866796.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.