DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and Zdhhc4

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_082655.1 Gene:Zdhhc4 / 72881 MGIID:1920131 Length:343 Species:Mus musculus


Alignment Length:168 Identity:49/168 - (29%)
Similarity:68/168 - (40%) Gaps:42/168 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 HCLGPFFVVGVAALTTSVVSIAYW-----------IGLPFWWAKSQLVTYFLLIVGNWLLLNVVF 113
            |...|.|:| :..|...:|...|.           ..||:     .|:.|.||.|      |:||
Mouse    62 HTRHPTFIV-LHLLLQGLVYAEYTCEVFGYCRELEFSLPY-----LLLPYVLLSV------NLVF 114

  Fly   114 HYVMAVITPAGHPPEGVSLVEAV-----------SMCGKCIAPKPPRTHHCSICNRCILKMDHHC 167
            ..:.....|........|.:..|           |.|..|...||.|:.||.:|:||:.:.||||
Mouse   115 FTLTCAANPGTITKANESFLLQVYKFDDVMFPKNSRCPTCDLRKPARSKHCRLCDRCVHRFDHHC 179

  Fly   168 PWLNNCVGYGNHRYFFLYM--------TYTTLGCLFLI 197
            .|:|||:|..|.|||.:|:        |..|:...||:
Mouse   180 VWVNNCIGAWNTRYFLIYLLTLTASAATIATVTAAFLL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 28/67 (42%)
Zdhhc4NP_082655.1 DHHC 151..292 CDD:396215 28/67 (42%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 340..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.