DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and Zdhhc25

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_081582.1 Gene:Zdhhc25 / 70073 MGIID:1917323 Length:279 Species:Mus musculus


Alignment Length:195 Identity:55/195 - (28%)
Similarity:81/195 - (41%) Gaps:69/195 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 WFVDNYTHCLGPFFVVGVAALTTSVVSIAYWIGLPFWWAKSQLVTYFLLIVGNWLLL-------- 109
            ||:      |.|   :|:      :.::|.|.               |::.|.|:|.        
Mouse    29 WFI------LDP---IGI------LCAMAAWA---------------LVLSGGWVLFRDLLIPSN 63

  Fly   110 --------NVVFH---------YVMAVIT-----PAGHPPEGVSLVEAVSMCGKCIAPKPPRTHH 152
                    .||||         ::..::|     |.|:||.    .:.||.|..|.:..|....|
Mouse    64 NMLYIVANGVVFHLLASLALASHLRTMLTDPGSVPLGNPPG----PDTVSYCTDCHSAIPRTACH 124

  Fly   153 CSICNRCILKMDHHCPWLNNCVGYGNHRYFFLYMTYTTL-GCLFLILFGLEIGHKYLWLDHGENW 216
            |::|.|||.|.||||||:|||:|..|.:||.|:..|..| ....|:|.|:.:...|:   .|| |
Mouse   125 CTVCQRCIRKNDHHCPWINNCIGEDNQKYFLLFTMYIGLTSTHVLLLLGIPVLCSYM---RGE-W 185

  Fly   217  216
            Mouse   186  185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 28/62 (45%)
Zdhhc25NP_081582.1 zf-DHHC 109..230 CDD:279823 34/81 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.