Sequence 1: | NP_651539.3 | Gene: | CG5880 / 43268 | FlyBaseID: | FBgn0039489 | Length: | 381 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_081582.1 | Gene: | Zdhhc25 / 70073 | MGIID: | 1917323 | Length: | 279 | Species: | Mus musculus |
Alignment Length: | 195 | Identity: | 55/195 - (28%) |
---|---|---|---|
Similarity: | 81/195 - (41%) | Gaps: | 69/195 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 WFVDNYTHCLGPFFVVGVAALTTSVVSIAYWIGLPFWWAKSQLVTYFLLIVGNWLLL-------- 109
Fly 110 --------NVVFH---------YVMAVIT-----PAGHPPEGVSLVEAVSMCGKCIAPKPPRTHH 152
Fly 153 CSICNRCILKMDHHCPWLNNCVGYGNHRYFFLYMTYTTL-GCLFLILFGLEIGHKYLWLDHGENW 216
Fly 217 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5880 | NP_651539.3 | zf-DHHC | 139..>201 | CDD:279823 | 28/62 (45%) |
Zdhhc25 | NP_081582.1 | zf-DHHC | 109..230 | CDD:279823 | 34/81 (42%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1491968at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |