DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and ZDHHC6

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001338011.1 Gene:ZDHHC6 / 64429 HGNCID:19160 Length:413 Species:Homo sapiens


Alignment Length:341 Identity:99/341 - (29%)
Similarity:147/341 - (43%) Gaps:95/341 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GPFFVVGVAAL--TTSVVSIAYWIGLPFW--WAKSQLVTYFLLIVGNWLLLNVVFHYVMAV---- 119
            ||...:||.|:  |.:::....|    :|  ......|.:.:||  ||.:: ::::|..|:    
Human    23 GPIIALGVIAICSTMAMIDSVLW----YWPLHTTGGSVNFIMLI--NWTVM-ILYNYFNAMFVGP 80

  Fly   120 -ITPAGHPPEGVSLVEAVSMCGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNHRYFF 183
             ..|.|..||.......:..|..|.|.|.||:|||..||||::||||||||:|||.||.||..|.
Human    81 GFVPLGWKPEISQDTMYLQYCKVCQAYKAPRSHHCRKCNRCVMKMDHHCPWINNCCGYQNHASFT 145

  Fly   184 LYMTYTTLGC-----LFLILFGLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSGHIIPVTHPNE 243
            |::....|||     :|::....::.|:   |..|.|          .||.::|           
Human   146 LFLLLAPLGCIHAAFIFVMTMYTQLYHR---LSFGWN----------TVKIDMS----------- 186

  Fly   244 YDEFVLPPAVHNLPTPIVDTDAASPGRRRALWFMAFTNVAVVLALGS------LSIWHAKLITRG 302
                    |....|.|||....|:         .|.|..|:.||||:      |.....|:|.|.
Human   187 --------AARRDPLPIVPFGLAA---------FATTLFALGLALGTTIAVGMLFFIQMKIILRN 234

  Fly   303 ETSVEAHINE--AERKRHLQQQRIYINPYNFGTKKNWKLFLGLVRGRSFWRTVLLPSWHKPEGTG 365
            :||:|:.|.|  .:|.::.|...:::.||:.|::  |:.|..:..    |..|       |||.|
Human   235 KTSIESWIEEKAKDRIQYYQLDEVFVFPYDMGSR--WRNFKQVFT----WSGV-------PEGDG 286

  Fly   366 LSFHTVNDAPFEDEWP 381
            |            |||
Human   287 L------------EWP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 34/66 (52%)
ZDHHC6NP_001338011.1 DHHC 95..241 CDD:396215 61/186 (33%)
SH3 317..394 CDD:418401
Di-lysine motif. /evidence=ECO:0000269|PubMed:21926431 410..413
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.