DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and zdhhc14

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001038652.1 Gene:zdhhc14 / 569667 ZFINID:ZDB-GENE-040724-21 Length:513 Species:Danio rerio


Alignment Length:321 Identity:73/321 - (22%)
Similarity:117/321 - (36%) Gaps:108/321 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GPFFVVGVAALTTSVVSIAYWIGLPFWWAKSQLVTYFLLIVGNWLLLNVVFHYVMAV-------- 119
            |.|::..|..|.||.:..|:  ..||  ..|.|......|.|      |:|.:||.:        
Zfish    61 GVFYLTMVLILVTSGLFFAF--DCPF--LASNLTPAIPAIGG------VLFVFVMGMLLRASFSD 115

  Fly   120 --ITPAGHPPEGVSL---VEA--------------------------VSMCGKCIAPKPPRTHHC 153
              :.|...|.|...:   ::|                          :..|..|...:|||..||
Zfish   116 PGVLPRATPEEAADIERQIDANNGPSGPGYRPPPRTREVLINGQTVKLKYCFTCKIFRPPRASHC 180

  Fly   154 SICNRCILKMDHHCPWLNNCVGYGNHRYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDHGENWTE 218
            |:|:.|:.:.||||||:.||||..|:|:|:|::  .:|..|.:.:|...|.|             
Zfish   181 SLCDNCVDRFDHHCPWVGNCVGRRNYRFFYLFI--LSLSFLTIFIFAFVITH------------- 230

  Fly   219 IEPLEGQPVKFNLSGHIIPVTHPNEYDEFVLPPAVHNLPTPIVDTDAASPGRRRALWFMAFTNVA 283
                    |..|.....:.::...:::      ||...||              .|.|:..:..|
Zfish   231 --------VILNALRKALALSTAADFE------AVQKDPT--------------GLAFLVLSKTA 267

  Fly   284 V------------VLALGSLSIWHAKLITRGETSVEAHINEAERKRHLQQQRIYINPYNFG 332
            :            |.::..||.:|..||:..:|:.|........||    .:...|||::|
Zfish   268 LLDVLEVVVCFFSVWSIVGLSGFHTYLISSNQTTNEDIKGSWSSKR----GKGNYNPYSYG 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 27/61 (44%)
zdhhc14NP_001038652.1 zf-DHHC 163..306 CDD:279823 46/185 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..369
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.