DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and zdhhc12b

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_021327289.1 Gene:zdhhc12b / 569129 ZFINID:ZDB-GENE-070705-356 Length:270 Species:Danio rerio


Alignment Length:282 Identity:64/282 - (22%)
Similarity:105/282 - (37%) Gaps:91/282 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LVTYFLLIVGNWLLLNVVFHYVMAVITPA-------------GHPPEGVSLVEAVS------MCG 140
            |...|:|:|    |::|:.::.::::.|.             |...|...::...:      .||
Zfish    45 LPVLFVLLV----LVSVLLYFAVSLMDPGFVLTDDCDLQFTLGIAEETQDMIPQTTKSIRLRRCG 105

  Fly   141 KCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNHRYFFLYMTYTTLGCLFLILFGLEIGH 205
            .|:..:|.|:.||..|..|:.:.||||||:.||||..|||:|.||:...    |.::|:||.:. 
Zfish   106 HCLVQQPMRSKHCQTCQHCVRRYDHHCPWIENCVGERNHRWFVLYLAVQ----LVVLLWGLYMA- 165

  Fly   206 KYLW--LDHGENWTEIEPLEGQPVKFNLSGHIIPVTHPNEYDEFVLPPAVHNLPTPIVDTDAASP 268
               |  ..|...|.:                                         .:.|:....
Zfish   166 ---WSGFSHASTWQQ-----------------------------------------WLRTNGVLL 186

  Fly   269 GRRRALWFMAFTNVAVVLALGSLSIWHAKLITRGETSVEAHINEAERKRHLQQQRIYINPYNFGT 333
            |....:..:|.|   |:|.|||    |..|::...|:.|  .....|..:|:......||::.|.
Zfish   187 GAAAVVAILALT---VLLLLGS----HLYLVSLNTTTWE--FMSRHRISYLKHCGADENPFDKGI 242

  Fly   334 KKN-WKLFLGLVRGRSFWRTVL 354
            .:| |..|..       |..|:
Zfish   243 LRNLWGFFCA-------WEPVV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 27/61 (44%)
zdhhc12bXP_021327289.1 zf-DHHC 97..>171 CDD:307600 30/81 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.