DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and zdhhc4

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_956343.2 Gene:zdhhc4 / 561817 ZFINID:ZDB-GENE-030131-9031 Length:345 Species:Danio rerio


Alignment Length:235 Identity:62/235 - (26%)
Similarity:87/235 - (37%) Gaps:75/235 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 CGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNHRYFFLYM-----------TYTTLG 192
            |..|...||.|:.||.:||||:.:.||||.|:|||:|..|.|||.||:           ..||..
Zfish   153 CSTCQLIKPARSKHCRVCNRCVQRFDHHCVWVNNCIGAQNTRYFMLYLLSVCAMAGNIAVLTTDM 217

  Fly   193 CLFLIL-FGLEIGHKYLWLDHGENWTEIEPLEG--QPVKFNLSGHIIPVTHPNEYDEFVLPPAVH 254
            .|..:| .||...|   ::|.          :|  ||     :|.:..:.|     .|:..|   
Zfish   218 LLQTVLRTGLLHAH---YIDE----------QGIQQP-----AGPLFIIQH-----LFLTFP--- 256

  Fly   255 NLPTPIVDTDAASPGRRRALWFMAFTNVAVVLALGSLSIWHAKLITRGETSVEAHINEAERKRHL 319
                             |.::.:.|. |.|...|....::|..|:...:||.|....:....:|.
Zfish   257 -----------------RIVFMLGFL-VFVFFLLAGYCLFHFYLVLVNQTSNEWFKAKGHNCQHC 303

  Fly   320 QQQ-----RIYINP----YNFGTKKNWKLFLGLVRGRSFW 350
            ...     |...||    |:.|..||        .|..||
Zfish   304 HPYSGHNCRTSYNPFRGFYHRGILKN--------IGEIFW 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 30/73 (41%)
zdhhc4NP_956343.2 DHHC 152..296 CDD:396215 51/186 (27%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 342..345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.