Sequence 1: | NP_651539.3 | Gene: | CG5880 / 43268 | FlyBaseID: | FBgn0039489 | Length: | 381 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001139020.1 | Gene: | ZDHHC7 / 55625 | HGNCID: | 18459 | Length: | 345 | Species: | Homo sapiens |
Alignment Length: | 245 | Identity: | 64/245 - (26%) |
---|---|---|---|
Similarity: | 97/245 - (39%) | Gaps: | 83/245 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 NAHMNSSYASDVCLTPIFWFVDNYTHCLGPFFVVGVAALTTSVVSIAYWIGLPFWWAKSQLVTYF 99
Fly 100 LLIVGN--WL-LLNVVFHYVMAVITPAGH------PPE---------------------GV---- 130
Fly 131 -----SLV----------------------EAVSMCGKCIAPKPPRTHHCSICNRCILKMDHHCP 168
Fly 169 WLNNCVGYGNHRYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDHGENWTE 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5880 | NP_651539.3 | zf-DHHC | 139..>201 | CDD:279823 | 34/61 (56%) |
ZDHHC7 | NP_001139020.1 | zf-DHHC | 168..295 | CDD:307600 | 39/81 (48%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1491968at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |