DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and ZDHHC4

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001358221.1 Gene:ZDHHC4 / 55146 HGNCID:18471 Length:359 Species:Homo sapiens


Alignment Length:231 Identity:58/231 - (25%)
Similarity:88/231 - (38%) Gaps:89/231 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 QLVTYFLLIVGNWLLLNV-VFHYVM------AVITPAGHP-------------PEGVSLVEAVSM 138
            :|..::||:  .:|||.| :|.:.:      .:||.|...             |:.|       .
Human    95 ELSLHYLLL--PYLLLGVNLFFFTLTCGTNPGIITKANELLFLHVYEFDEVMFPKNV-------R 150

  Fly   139 CGKCIAPKPPRTHHCS---------------ICNRCILKMDHHCPWLNNCVGYGNHRYFFLYM-- 186
            |..|...||.|:.|||               :||.|:.:.||||.|:|||:|..|.|||.:|:  
Human   151 CSTCDLRKPARSKHCSECGSRDSSGTSNSTCVCNWCVHRFDHHCVWVNNCIGAWNIRYFLIYVLT 215

  Fly   187 ------TYTTLGCLFLILFGL-----------EIGH----------KYLWLDHGENWTEIEPLEG 224
                  |...:...||:...:           ::||          :||:|    .:..|..:.|
Human   216 LTASAATVAIVSTTFLVHLVVMSDLYQETYIDDLGHLHVMDTVFLIQYLFL----TFPRIVFMLG 276

  Fly   225 QPV--KFNLSGHIIPVTHPNEYDEFVLPPAVHNLPT 258
            ..|  .|.|.|:::          |||..|..|..|
Human   277 FVVVLSFLLGGYLL----------FVLYLAATNQTT 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 28/84 (33%)
ZDHHC4NP_001358221.1 DHHC 151..307 CDD:366691 45/166 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.