DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and ZDHHC3

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_016862050.1 Gene:ZDHHC3 / 51304 HGNCID:18470 Length:378 Species:Homo sapiens


Alignment Length:213 Identity:68/213 - (31%)
Similarity:98/213 - (46%) Gaps:36/213 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 CLTPIF-------WFVDNYTHCLGPFFVVGVAALTTSVVSIAYWIGLPFWWAKSQLVTYFLL--I 102
            |:.|.:       ||:.:  .|     .:..|.:|..:|..|.::.|......|:...|.::  |
Human    24 CVPPPYPGPVGTMWFIRD--GC-----GIACAIVTWFLVLYAEFVVLFVMLIPSRDYVYSIINGI 81

  Fly   103 VGNWLLLNVVFHYVMAVITPAGHPPEGVSLVE-----------AVSMCGKCIAPKPPRTHHCSIC 156
            |.|.|....:..:..|::|..|..|:|.:..|           .|..|.||.:.||.|.||||:|
Human    82 VFNLLAFLALASHCRAMLTDPGAVPKGNATKEFIESLQLKPGQVVYKCPKCCSIKPDRAHHCSVC 146

  Fly   157 NRCILKMDHHCPWLNNCVGYGNHRYFFLYMTYTTLGCLF-LILFGLEIGHKYL--WLDHGENWTE 218
            .|||.||||||||:|||||..|.:||.|:..|..|..|. ||:.|....|.:.  |..:|.|..|
Human   147 KRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIALISLHALIMVGFHFLHCFEEDWTTYGLNREE 211

  Fly   219 IEPL------EGQPVKFN 230
            :...      :.||:.|:
Human   212 MAETGISLHEKMQPLNFS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 36/62 (58%)
ZDHHC3XP_016862050.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.