DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and ZDHHC2

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_011542846.1 Gene:ZDHHC2 / 51201 HGNCID:18469 Length:412 Species:Homo sapiens


Alignment Length:411 Identity:102/411 - (24%)
Similarity:157/411 - (38%) Gaps:125/411 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 HSTQELLSILRLRWSYMKHCWHSLTFNAHMNSSYASDVCLTPIFWFVDNYTHCLGPFFVVGVAAL 73
            |.....|.:||||...:    ||: ...|..:|...:.|.|            ||..|...:|.:
Human    30 HHPPARLVLLRLRHPAV----HSV-HGKHWRTSLQIEFCQT------------LGKEFYPEMAVI 77

  Fly    74 TTSVVSIAYWI--GLPFWWAKSQLVTYFLLIVGNWLLL----------------NVVFHYVMAVI 120
            ...::.....:  ||     .|......|:|:.|:|.:                .:.||...|..
Human    78 VPEILKALSCVPDGL-----SSTFCNVCLVILENYLYITNESFKRNGATGFEHETIKFHLSYAEK 137

  Fly   121 TPAGHPPEGVSLVE------------------AVSMCGKCIAPKPPRTHHCSICNRCILKMDHHC 167
            ......|.|.:..|                  |:..|.:|...||.|.||||:|::|||||||||
Human   138 DLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRCQLIKPDRCHHCSVCDKCILKMDHHC 202

  Fly   168 PWLNNCVGYGNHRYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLS 232
            ||:|||||:.|:::|.|::.|:.|.|||:....|:...|:        ||               
Human   203 PWVNNCVGFSNYKFFLLFLAYSLLYCLFIAATDLQYFIKF--------WT--------------- 244

  Fly   233 GHIIPVTHPNEYDEFVLPPAVHNLPTPIVDTDAASPGRRRALWFMAFTNVAVVLALGSLSIWHAK 297
                                 :.||    ||.|     :..:.|:.|......::|.||..:|..
Human   245 ---------------------NGLP----DTQA-----KFHIMFLFFAAAMFSVSLSSLFGYHCW 279

  Fly   298 LITRGETSVEAHINEAERKRHLQQQRIYINPYNFGTKKNWKLFLGLVRGRSFWRTVLLPSWHKPE 362
            |:::.::::||.  .:...||...:    |.::.|..||.:...|  ..:.:|   |||.: ...
Human   280 LVSKNKSTLEAF--RSPVFRHGTDK----NGFSLGFSKNMRQVFG--DEKKYW---LLPIF-SSL 332

  Fly   363 GTGLSFHT--VNDAPFEDEWP 381
            |.|.||.|  ||..|.:...|
Human   333 GDGCSFPTCLVNQDPEQASTP 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 34/61 (56%)
ZDHHC2XP_011542846.1 zf-DHHC 172..293 CDD:279823 52/175 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55511
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.