DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and Zdhhc14

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001034432.1 Gene:Zdhhc14 / 499014 RGDID:1565877 Length:489 Species:Rattus norvegicus


Alignment Length:312 Identity:66/312 - (21%)
Similarity:114/312 - (36%) Gaps:110/312 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GPFFVVGVAALTTSVVSIAY---WIGLPFWWAKSQLVTYFLLIVGNWLLLNVVFHYVMAV----- 119
            |.|::..:..|.||.:..|:   ::        ::.:|..:.:||     .::|.:||..     
  Rat    62 GVFYLTLILILVTSGLFFAFDCRYL--------AEKITPAIPVVG-----GILFFFVMGTLLRTS 113

  Fly   120 -----ITPAGHPPEGVSLVEAVSM-----------------------------CGKCIAPKPPRT 150
                 :.|...|.|...|...:.:                             |..|...:|||.
  Rat   114 FSDPGVLPRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVIINGQTVKLKYCFTCKIFRPPRA 178

  Fly   151 HHCSICNRCILKMDHHCPWLNNCVGYGNHRYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDHGEN 215
            .|||:|:.|:.:.||||||:.||||..|:|:|  ||...:|..|.:.:|...|.|          
  Rat   179 SHCSLCDNCVEQFDHHCPWVGNCVGKRNYRFF--YMFILSLSFLTVFIFAFVITH---------- 231

  Fly   216 WTEIEPLEGQPVKFNLSGHIIPVTHPNEYDEFVLPPAVHNLPTPIVDTDAASPGRRRALWFMAFT 280
                                  |.|.::...|:  .|:.:.|..:::.            .:.|.
  Rat   232 ----------------------VIHRSQQKGFL--DALKDSPASVLEA------------VICFF 260

  Fly   281 NVAVVLALGSLSIWHAKLITRGETSVEAHINEAERKRHLQQQRIYINPYNFG 332
            :|..::   .||.:|..||:..:|:.|........||..:.    .|||::|
  Rat   261 SVWSII---GLSGFHTYLISSNQTTNEDIKGSWSNKRGKEN----YNPYSYG 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 28/61 (46%)
Zdhhc14NP_001034432.1 DHHC 164..287 CDD:396215 44/173 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.