DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and Zdhhc11

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_038942712.1 Gene:Zdhhc11 / 499000 RGDID:1564281 Length:364 Species:Rattus norvegicus


Alignment Length:289 Identity:71/289 - (24%)
Similarity:113/289 - (39%) Gaps:79/289 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LTTSVVSIAYWIG-LPFWWAKSQLVTYFLLIVGNWLLLNVVFHYVMAVITPAGHPPEGVSL---- 132
            |..|:|:...:|. ||..|..:...     ::|...:.::|.|.:...|.||   ...|.|    
  Rat    53 LAMSIVTFGIFIPFLPTSWKYAANA-----VMGGVFMFHLVVHLIAITIDPA---DTNVRLKKDY 109

  Fly   133 VEAV--------------SMCGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNHRYFF 183
            :|.|              ..|..|......:..|||.||:|:...||||.|||||||..|:.:||
  Rat   110 LEPVPTFDRSKHAHVIQNQYCHLCEVTVSKKAKHCSSCNKCVSGFDHHCKWLNNCVGKRNYWFFF 174

  Fly   184 LYM---TYTTLGCLFLILF----------GLEIGHKY----LWLDHGENWTEIEPLEGQPVKFNL 231
            ..:   .:..||.|.::|:          ||.:...|    :|:  |..||.:..          
  Rat   175 FSVASAAFGLLGVLIILLYIFIQYFVNPNGLRMDPLYKGAAVWI--GAGWTCLSV---------- 227

  Fly   232 SGHIIPVTHPNEYDEFV-LPPAVHNLPTPIVDTDAASPGRRRALWFMAFTNVAVVLALGSLSIWH 295
               .|.::..|.:..|: |.|.  .:.||:|.:.||         .:....:|..:.||.|.::|
  Rat   228 ---FIEISSENTWLLFLSLSPV--PVKTPVVLSIAA---------MVLLLAIASFVLLGHLLVFH 278

  Fly   296 AKLITRG--------ETSVEAHINEAERK 316
            ..||::.        :|..:.....||:|
  Rat   279 FYLISKKLSTFDYMMQTRFQKSPRPAEKK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 26/74 (35%)
Zdhhc11XP_038942712.1 DHHC 123..294 CDD:396215 50/196 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.