DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and CG4956

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster


Alignment Length:128 Identity:44/128 - (34%)
Similarity:62/128 - (48%) Gaps:22/128 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGNWLLLNVVFHYVMAVITPAGHPPEG-VSLVEAVSMCGKCIAPKPPRTHHCSICNRCILKMDH 165
            |:|||.|..:....|.:::....:|..| ..|....|.|.|.:   |||:.|||:||.||||.||
  Fly    90 ILGNWWLGCMTNTSVDSLVLERQYPVAGEAHLWHYCSTCQKLV---PPRSWHCSLCNICILKRDH 151

  Fly   166 HCPWLNNCVGYGNHRYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDHG-ENWTE-----IEPL 222
            ||.:..:|:|:.|.|||..:            ||.|..|.....:.:| .|||.     ::||
  Fly   152 HCTFFASCIGHKNQRYFLAF------------LFHLSFGSGQALVYNGILNWTNKAFLVVDPL 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 26/61 (43%)
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 35/95 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.