DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and CG17197

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster


Alignment Length:360 Identity:86/360 - (23%)
Similarity:126/360 - (35%) Gaps:132/360 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VCLTPIFWFVDNYTHCLGPFFVVGVAALTTSVVSIAYWIGLPFWWAKSQLVTYFLLIVGNWLLLN 110
            |.:|.||:.|      |..|:||   .....|....|.:|    |..:..:||  .|.||.|..:
  Fly    31 VIVTTIFFVV------LQMFYVV---PQLFDVQGFMYKLG----WLVAIFITY--NIFGNMLACH 80

  Fly   111 VVFHYVMAVITPAGHPPEGVSLVEAVS-----MCGKCIAPKPPRTHHCSICNRCILKMDHHCPWL 170
            :....|.::       |:...:.|...     .|..|....|||:.||.:|..||||.|.||.:.
  Fly    81 ITSTSVESL-------PKDRQIPEPEEEHQWHYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFT 138

  Fly   171 NNCVGYGNHRYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSGHI 235
            .:|||:.|.||||.:..:..||                        |.:.          |:.||
  Fly   139 ASCVGHNNQRYFFWFTLFMALG------------------------TGVA----------LATHI 169

  Fly   236 IPVTHPNEYDEFV---LPPAVHNLP------TPIVDTDAASPGRRRALWFMAFTNVAVVLALGSL 291
            |.......|.:.:   :|.  .|||      |.|::|           :..|....:|::.|..|
  Fly   170 IATLKYFSYSDLIFLNIPR--DNLPPFWLVITLILNT-----------YVFAAPVSSVLMQLSVL 221

  Fly   292 SIWHAKLITRGETSVEAHINEAERKRHLQQQRIYINPYNFGTKKNWKLFLGLVRGRSFWRTVLLP 356
                                    |.:....:.|.:.|:.|..:|:||.||   |:.|| |.|.|
  Fly   222 ------------------------KNNGTLHKFYSDTYDLGLWENFKLILG---GKGFW-TFLSP 258

  Fly   357 S-----------W-------HKPEGTGLSFHTVND 373
            :           |       |.|:   |.|..|:|
  Fly   259 TVKSPLPHDGAQWKIKRVQHHSPK---LQFLRVSD 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 25/61 (41%)
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 13/51 (25%)
zf-DHHC 100..>198 CDD:279823 35/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.