DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and Zdhhc12

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001013257.1 Gene:Zdhhc12 / 366014 RGDID:1306593 Length:267 Species:Rattus norvegicus


Alignment Length:291 Identity:73/291 - (25%)
Similarity:118/291 - (40%) Gaps:76/291 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 WWAKSQL---VTYFLLIVGNWLLLNVVF----HYVMAVITPAGHPPEGVSLV--EAVSM--CGKC 142
            |..:.:|   :|:.||::|:.||...|.    .||.|...|...|.|..:.:  :|:.:  |..|
  Rat    38 WEEQGELFLPLTFLLLVLGSLLLYLAVSLMDPGYVTAQPQPQEEPKEEQTAMVPQAIPLRRCRYC 102

  Fly   143 IAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNHRYFFLYMTYTTLGCLFLILFGLEIGHKY 207
            :..:|.|..||..|.||:.:.||||||:.||||..||..|..|:...    |.::|:||.:.   
  Rat   103 LVLQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHPLFVAYLALQ----LVVLLWGLYLA--- 160

  Fly   208 LWLDHGENWTEIEPLEGQPVKFNLSGHIIPVTHPNEYDEFVLPPAVHNLPTPIVDTDAASPGRRR 272
                    |:.::..:...:....:|.:        :..|:|                       
  Rat   161 --------WSGLQFFQPWGLWLRSTGLL--------FTTFLL----------------------- 186

  Fly   273 ALWFMAFTNVAVVLALGSLSIWHAKLITRGETSVEAHINEAERKRHLQQQRIYINPYNFGTKKNW 337
                ::|..:.|.|.|.|    |..|:.|..|:.|  ...:.|..:|:|:.  .||::.|..:|.
  Rat   187 ----LSFFALVVSLLLAS----HLYLVARNTTTWE--FISSHRIAYLRQRT--SNPFDRGPTRNL 239

  Fly   338 -KLFLGLVRGRSFWRTVLLPSWHKPEGTGLS 367
             ..|.|...|.  |.|:    |.:.|..|.|
  Rat   240 AHFFCGWPSGP--WETL----WAEEEEEGSS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 25/61 (41%)
Zdhhc12NP_001013257.1 DHHC <123..217 CDD:396215 32/149 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.