DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and Zdhhc13

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001382044.1 Gene:Zdhhc13 / 365252 RGDID:1309736 Length:622 Species:Rattus norvegicus


Alignment Length:393 Identity:85/393 - (21%)
Similarity:133/393 - (33%) Gaps:148/393 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WSYMKHC-------------W---HSLTFNAHMNSSYASDVCLTPIFWFVDNYTHCLGPFFVVGV 70
            |.::..|             |   :.|.||   :.|:....||.....|:.:    |.|.|:||.
  Rat   284 WQWLHKCELFLLLVLSMISLWAVGYILNFN---SDSWLLKGCLLVALLFLTS----LFPRFLVGY 341

  Fly    71 AAL----TTSVVSIAYWI-------------GLPFWWAKSQLVTYFLLIVGNWLLLNVVFHYVMA 118
            ..|    |..::|..:||             |.||::|....:..||..          |:...|
  Rat   342 KNLVYLPTVFLLSSIFWIFMTWFILFFPDAAGSPFYFAFIFSIMAFLYF----------FYKTWA 396

  Fly   119 V---ITPAGHPPEGVSLVEAV--------SMCGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNN 172
            .   .|.|......|::|...        :.|..|:..||.|:.||.:||.|:.:.|.||.|...
  Rat   397 TDPGFTKASEEERKVNIVTLAETGSLDFRTFCTSCLIRKPLRSLHCHVCNSCVARFDQHCFWTGR 461

  Fly   173 CVGYGNHRYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDHGEN-------WTEIEPLEGQPVKFN 230
            |:|:|||.::..::...::.|.::|     .|....|.:|...       ||.:..:.       
  Rat   462 CIGFGNHHHYIFFLLSLSMVCDWII-----YGSFVYWSNHCATTFKEDGLWTYLNQIV------- 514

  Fly   231 LSGHIIPVTHPNEYDEFVLPPAVHNLPTPIVDTDAASPGRRRALWFMAFTNVAVVLALGSLSIWH 295
                                              |.||      |         ||.:..|:.:|
  Rat   515 ----------------------------------ACSP------W---------VLYIFMLAAFH 530

  Fly   296 AK-----LITR-------GETSVEAHINEAERKRHLQQQ-RIYINPYNFGTKKNWKLF-----LG 342
            ..     ||.:       |.||.| .|:..::.||::|. .:...|||.|..:|...|     .|
  Rat   531 FSWSTFLLINQLFQIAFLGLTSHE-RISLLKQSRHMKQTLSLRKTPYNLGFMQNLADFFQCGCFG 594

  Fly   343 LVR 345
            ||:
  Rat   595 LVK 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 21/61 (34%)
Zdhhc13NP_001382044.1 Ank_2 66..>269 CDD:423045
ANK repeat 81..112 CDD:293786
ANK repeat 114..146 CDD:293786
ANK repeat 148..179 CDD:293786
ANK repeat 181..247 CDD:293786
DHHC 423..557 CDD:396215 40/195 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.