DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and GABPI

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster


Alignment Length:385 Identity:72/385 - (18%)
Similarity:122/385 - (31%) Gaps:172/385 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LGPFFVV----GVAALT--TSVVSIAYWIGLPFWW----AKSQLVTYFLLIVGNWLLLNV----- 111
            :.|.|:|    |:|.|.  |::|.:...:|...|.    .::...|.|.|   :||:.:|     
  Fly   102 VAPAFIVPLMLGLATLNSKTAIVLMLTLVGFTIWGMELAKRTATRTNFFL---SWLVFSVFYMII 163

  Fly   112 VFHYVMAVITPAGHPPEGVSL-------------------------------------------- 132
            :|.:.:.::..|  |.|..:|                                            
  Fly   164 IFEFQVPLLELA--PEENYALMFFSCAALYCLYSAKALSPLNLVSAQYGTTPKDELPGIAEASSG 226

  Fly   133 -----------VEAV------------------------SMCGKCIAPKPPRTHHCSICNRCILK 162
                       :|:|                        ::|..|....|.|.:||.:|..|:.:
  Fly   227 EEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNICEICRKVTPRRAYHCPVCGTCVKR 291

  Fly   163 MDHHCPWLNNCVGYGNHRYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDHGENWTEIEPLEGQPV 227
            .|||..|||.|:|..|                            |:|...|...:||..|.|.  
  Fly   292 RDHHSYWLNCCIGERN----------------------------YVWYIVGLALSEIALLLGA-- 326

  Fly   228 KFNLSGHIIPVTHPNEYDEFVLPPAVHNLPTPIVDTDAAS---PGRRRALWF-------MAFTNV 282
              ||:  :..:.||     |::   |..|..|::..|..|   .|....:.|       :..:.:
  Fly   327 --NLT--LTSICHP-----FMV---VRPLGYPVLLPDDCSEVFEGFDLGISFVVACYALLISSYI 379

  Fly   283 AVVLALGSLSIWHAKLITRGETSVEAHINEAERKRHLQ-QQRIYINPYNFGTKKNWKLFL 341
            |.:||..:...|      :|.|     ::|.:|..:.. :.||:         .||:..|
  Fly   380 AFILARQAYLWW------KGST-----LHEYKRTSNAAGRNRIW---------SNWRAIL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 17/61 (28%)
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 42/189 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.