DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and CG17075

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster


Alignment Length:386 Identity:87/386 - (22%)
Similarity:137/386 - (35%) Gaps:94/386 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LGPFFVVGVAALTTSVVSIAYWIGLPFWWAKSQLVTYFLLIVGNWLLLNVVFHYVMAVITPAGH- 125
            |.|..:.|...|....|: :||:.:|.:.|:.|...|. ||.|.: |:::..|....:..||.. 
  Fly   110 LHPLQIFGWLVLLLFGVA-SYWVLIPAFHARIQGPLYG-LITGLY-LVHIASHLTALLTDPADKE 171

  Fly   126 -----------PPEGVSLVEAVSMCGKC----IAPKPPRTHHCSICNRCILKMDHHCPWLNNCVG 175
                       |....|....|...|:|    |.....||.|||:||:|:.|.||||.|||:|:|
  Fly   172 LRRVHRNDRIVPEFDRSKHSHVIENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIG 236

  Fly   176 YGNHRYFFLYMTYTTLGCLFLILFGL-EIGHKYL---WLDHGENWTEIEPLEGQPVKFNLSGHII 236
            ..|:..|.:.:....:..|.::...: :|...|:   ||..  .|...|  ....::   ||..|
  Fly   237 SRNYVAFLMCVVSAVVATLVIVAAVVAQIVFYYIQPDWLSF--YWCPTE--SSHTIE---SGDFI 294

  Fly   237 PVT--------------------HPNEYDE-------FVLPPAVHNLPTPIVDTDAASPG----- 269
            .:|                    |...:||       ..||..:.|. |.|::..|..||     
  Fly   295 NITLSLSNGTMMLIEQHTSEEDVHQEMWDEEQANMTISTLPTLLENF-TAIIEASATRPGISPTN 358

  Fly   270 -----------RRRALWFMAFTNVAVVLALGS------LSIWHAKLITRGETSVEAHINEAERKR 317
                       ......||....|..:||..|      |..:|..:...|.|:.| :|....:.:
  Fly   359 HTETQPVVTGIGLNETIFMFLLGVLGLLAAVSAGLLLHLCFFHIYISFLGLTTYE-YIRNHRQAQ 422

  Fly   318 HLQQQRIYINPYNFGTKKNWKLFLGLVRGRSFWRTVLLPSWHKPEGT---GLSFHTVNDAP 375
            ..:.:::..........||..:..          :..||..|.|..:   |...:..:.||
  Fly   423 DAKTKQLLEGAPGVRAPKNGNVHF----------SASLPEPHNPSKSLPGGQQLYCCSSAP 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 24/65 (37%)
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 28/84 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.