DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and Zdhhc15

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001034190.1 Gene:Zdhhc15 / 317235 RGDID:1562075 Length:337 Species:Rattus norvegicus


Alignment Length:259 Identity:74/259 - (28%)
Similarity:108/259 - (41%) Gaps:84/259 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 AVSMCGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNHRYFFLYMTYTTLGCLFLILF 199
            ||..|.:|...||.|.||||:|..|:|||||||||:|||:|:.|:::|..::.|:.|.||::...
  Rat   127 AVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATT 191

  Fly   200 GLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSGHIIPVTHPNEYDEFVLPPAVHNLPTPIVDTD 264
            ......|| |  .||       |.....||    |::          |:|..|            
  Rat   192 VFSYFIKY-W--RGE-------LPSVRSKF----HVL----------FLLFVA------------ 220

  Fly   265 AASPGRRRALWFMAFTNVAVVLALGSLSIWHAKLITRGETSVEAH----INEAERKRHLQQQRIY 325
                    .::|     |::|:..|    :|..|::|.:|::||.    ......|         
  Rat   221 --------CMFF-----VSLVILFG----YHCWLVSRNKTTLEAFCTPVFTSGPEK--------- 259

  Fly   326 INPYNFGTKKNWKLFLGLVRGRSFWRTVLLPSWHKPEGTGLSFH-----------TVNDAPFED 378
             |.:|.|..||.:...|  ..:.||   |:|....| |.|.||.           ..|:.|:||
  Rat   260 -NGFNLGFIKNIQQVFG--DNKKFW---LIPIGSSP-GDGHSFPMRSMNESQNPLLANEEPWED 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 30/61 (49%)
Zdhhc15NP_001034190.1 zf-DHHC <125..308 CDD:303066 70/249 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..337 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55511
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.