DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and Zdhhc9

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001034105.2 Gene:Zdhhc9 / 302808 RGDID:1561389 Length:364 Species:Rattus norvegicus


Alignment Length:255 Identity:62/255 - (24%)
Similarity:100/255 - (39%) Gaps:69/255 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 PAG-HPPEGV------SLVEAVSMCGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNH 179
            |.| .||..:      :.:..:..|..|...:|||..|||||:.|:.:.||||||:.||||..|:
  Rat   117 PQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNY 181

  Fly   180 RYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSGHIIPVTHPNEY 244
            |||:|::...:|..:::..|                                  :|:.|      
  Rat   182 RYFYLFILSLSLLTIYVFAF----------------------------------NIVYV------ 206

  Fly   245 DEFVLPPAVHNLPTPIVDTDAASPGRRRALWFMAFTNVAVVLALGSLSIWHAKLITRGETSVEAH 309
                   |:.:|....::|...:||....:....||..:||    .|:.:|..|:...:|:.|..
  Rat   207 -------ALKSLKIGFLETLKETPGTVLEVLICFFTLWSVV----GLTGFHTFLVALNQTTNEDI 260

  Fly   310 INEAERKRHLQQQRIYINPYNFG--TKKNWKLFLGLVRGRSFWRTVLLP---SWHKPEGT 364
            ......|..:|      |||:.|  .|...::..|.:......|..:||   |..:|..|
  Rat   261 KGSWTGKNRVQ------NPYSHGNIVKNCCEVLCGPLPPSVLDRRGILPLEESGSRPPST 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 28/61 (46%)
Zdhhc9NP_001034105.2 zf-DHHC 138..261 CDD:279823 44/173 (25%)
ANXA2R <284..>343 CDD:292349 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.