DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and Zdhhc22

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001034414.1 Gene:Zdhhc22 / 299211 RGDID:1308446 Length:263 Species:Rattus norvegicus


Alignment Length:246 Identity:64/246 - (26%)
Similarity:96/246 - (39%) Gaps:61/246 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 WLLLNVVFHYVMAVITPAGHPPEGVSLVEAVSMCGKCIAPK--PPRTHHCSICNRCILKMDHHCP 168
            :|..|.:.:|::.|    .:.|:.:...:..|    ...|:  ||.||.|.:|.|..|:.||||.
  Rat    56 FLSANALGNYILVV----QNSPDDLGACQGTS----SQRPQRPPPSTHFCRVCARVTLRHDHHCF 112

  Fly   169 WLNNCVGYGNHRYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSG 233
            :..||:|..|.|.|.|:..||:|.||:.::.|:..                       :...|| 
  Rat   113 FTGNCIGSRNMRNFILFCLYTSLACLYSMVAGVAY-----------------------ISAVLS- 153

  Fly   234 HIIPVTHPNEYDEFVLPPAVHNLPTPIVD-TDAASPGRRRALWFMAFTNVAVVLALGSLSIWHAK 297
              |...||..:        :..|||.|.. ...|..|....:..|.:...||.||..........
  Rat   154 --ISFAHPLAF--------LTLLPTSISQFFSGAVLGSDMFVILMLYLWFAVGLACAGFCCHQLL 208

  Fly   298 LITRGETSVEAHINEAER----KRHLQQQRIYINPYNFGTKKNWKLFLGLV 344
            ||.||:|..:.....|.|    :::||:.        ||  |.|  .|||:
  Rat   209 LILRGQTRYQVRKGVAVRARPWRKNLQEV--------FG--KRW--LLGLL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 25/63 (40%)
Zdhhc22NP_001034414.1 DHHC 91..218 CDD:396215 46/160 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.