DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and Zdhhc24

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001034189.1 Gene:Zdhhc24 / 293665 RGDID:1565630 Length:284 Species:Rattus norvegicus


Alignment Length:251 Identity:69/251 - (27%)
Similarity:96/251 - (38%) Gaps:64/251 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 GVSLVEAVSMCGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNHRYFFLYMTYTTLGC 193
            |..|.:..:.|.:|.:..|||:.|||.|..|||:.||||..|..|||:.|:|.|.         |
  Rat    86 GRGLGQGWAYCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGRCVGFHNYRPFL---------C 141

  Fly   194 LFLILFGLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSGHIIPVTHPNEYDEFVLPPAVHNLPT 258
            |.|...|:.:              .|..|....:...|..|....|           .|:..||.
  Rat   142 LLLHAAGVLL--------------HISVLLSPALSALLQAHSALYT-----------VALLLLPW 181

  Fly   259 PIVDTDAASPGRRRALWFMAFTNVAVVLALGSLSIWHAKLITRGETSVEAHINEAERKRHLQQQR 323
            .::.|...|.. :.||.|:..|.||..|..|:..::|..|:.||:|:.     |..|.:|     
  Rat   182 LMLLTGKVSLA-QFALAFVVDTCVAGALLCGAGLLFHGMLLLRGQTTW-----EWARGQH----- 235

  Fly   324 IYINPYNFGTKKNWKLFLGLVRGRSFWRTVLLPSWHKP------EGTGLSFHTVND 373
                .|:.|...|.:..||     ..|..|    |..|      .|.|::|.|..|
  Rat   236 ----SYDLGMSHNLQAALG-----PRWALV----WFWPFLASPLPGDGITFQTPTD 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 26/61 (43%)
Zdhhc24NP_001034189.1 zf-DHHC 95..234 CDD:279823 52/178 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.