DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and Zdhhc1

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_008770707.1 Gene:Zdhhc1 / 291967 RGDID:1589775 Length:502 Species:Rattus norvegicus


Alignment Length:307 Identity:74/307 - (24%)
Similarity:114/307 - (37%) Gaps:90/307 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 FFVVGVAALTTSVVSIAYWIGLPFWWAKSQLVTYFLLIVGNWLLLNVVFHYVMAVITPA------ 123
            |.|:|...|...         ||..|..:.......:..|     ::|.|.....|.||      
  Rat    59 FAVIGFGVLVPL---------LPHHWVPAGYACMGAIFAG-----HLVVHLTAVSIDPADANVRD 109

  Fly   124 ----GHPP-----EGVSLVEAVSMCGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNH 179
                |..|     :...::|.:. |..|......|:.|||.||:|:...||||.|||||||..|:
  Rat   110 KSYSGPLPIFNRSQHAHVIEDLH-CNLCDVDVSARSKHCSACNKCVCGFDHHCKWLNNCVGERNY 173

  Fly   180 RYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSGHI-IPVTHPNE 243
            |.|...:....||.|.|:|..     .|::::...|          |::...:.|. :...|.:.
  Rat   174 RLFLHSVASALLGVLLLVLVA-----TYVFVEFFVN----------PMRLRTNQHFEVLKNHTDV 223

  Fly   244 YDEFVLPPAVHNLPTPIVDTDAASPGRRRALWFMAFTNVAVVLALGSLS--------------IW 294
            :..|        ||...|:|.|.      |:..:|    |:::.||.||              :|
  Rat   224 WFVF--------LPAAPVETQAP------AILALA----ALLILLGLLSTALLGHLLCFHIYLMW 270

  Fly   295 HAKLIT--------RGETSVEAH--INEAERK-RHLQQQRIYINPYN 330
            | ||.|        ..:.:.|.|  :....|| |.:|:...|:..::
  Rat   271 H-KLTTYEYIVQHRPAQEAKETHKELESCPRKMRSIQEMEFYMRTFS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 28/61 (46%)
Zdhhc1XP_008770707.1 DHHC 126..281 CDD:396215 52/189 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.