DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001034348.1 Gene:Zdhhc19 / 288045 RGDID:1309014 Length:359 Species:Rattus norvegicus


Alignment Length:341 Identity:76/341 - (22%)
Similarity:119/341 - (34%) Gaps:115/341 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PIFWFVDNYTHCLGPFFVVGVAALTTSVVSIAYWIGLPFWWAKSQLVTYFLLIVGNW-------- 106
            |:.||..:.........:|.::.|         :.|.|..|         |:..|.|        
  Rat    24 PLSWFFPSLFAAFNVSLLVFLSGL---------FFGFPCRW---------LVQNGEWVFPAVTGP 70

  Fly   107 LLLNVVFHYVMAVITPAG--------HPPEGVSLVEA------VSMCGKCIAPKPPRTHHCSICN 157
            |.:...|..|....:..|        ..|..|.:|..      :..|.||:..:||||:||..||
  Rat    71 LFILTFFSLVSLNFSDPGILHRGSVSEDPRTVHVVRVNQRAFRLEWCPKCLFHRPPRTYHCPWCN 135

  Fly   158 RCILKMDHHCPWLNNCVGYGNHRYFFLYMTYTTL--GCLFL--ILFGLEIGHKYLWLDHGENWTE 218
            .|:...||||.|:|||:|:.|.|.|.|.:.:..|  |.|.:  ::|.:...|....||..     
  Rat   136 ICVEDFDHHCKWVNNCIGHRNFRLFVLLILFLCLYSGALLVTCLMFLIHTSHLPFSLDKA----- 195

  Fly   219 IEPLEGQPVKFNLSGHIIPVTHPNEYDEFVLPPAVHNLPTPIVDTDAASPGRRRALWFMAFTNVA 283
            :..|...|.    :|.:||:        |:|                                  
  Rat   196 MAILVAVPA----AGFLIPL--------FLL---------------------------------- 214

  Fly   284 VVLALGSLSIWHAKLITRGETSVEAHINEAERKRHLQQQRIYINPYNFGTKKNWKLFLGLVRGRS 348
              :.:.:||      ::|.|.|.|:...:.|.          .||::.|..|||.|.:....|.:
  Rat   215 --MLIQALS------VSRAERSYESKCRDHEE----------YNPFDQGFAKNWYLTMCAPLGPN 261

  Fly   349 FWRTVLLPSWHKPEGT 364
            :...|:  ...:|.||
  Rat   262 YMSEVV--CLQRPVGT 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 29/65 (45%)
Zdhhc19NP_001034348.1 zf-DHHC 112..230 CDD:279823 44/176 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.