DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and Zdhhc8

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001365948.1 Gene:Zdhhc8 / 27801 MGIID:1338012 Length:775 Species:Mus musculus


Alignment Length:289 Identity:67/289 - (23%)
Similarity:102/289 - (35%) Gaps:102/289 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LPFWWAKSQLV---TYFLLIVGNWLLL----------NVVFHYVMAVITPAGHPPEGV------- 130
            :|...|.:.||   |.|.:....||..          .::|.:|:|..:.|.....||       
Mouse    15 IPVATAAALLVGSSTLFFVFTCPWLTRAVSPAIPVYNGILFLFVLANFSMATFMDPGVFPRADED 79

  Fly   131 ------------------SLVEAVSMCGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYG 177
                              .:...:..|..|...:|||..|||:|:.|:...||||||:|||:|..
Mouse    80 EDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRR 144

  Fly   178 NHRYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSGHIIPVTHPN 242
            |:|||||::...:...:.::.|||    .|: |:|.|..                          
Mouse   145 NYRYFFLFLLSLSAHMVGVVAFGL----LYV-LNHSEGL-------------------------- 178

  Fly   243 EYDEFVLPPAVHNLPTPIVDTDAASPGRRRALWFMAFTNVAVVLALGSLSIWHAKLITRGETSVE 307
                    .|.|...|..|               |....:..:..:| |:.:|..|:|||.|:  
Mouse   179 --------GAAHTTITMAV---------------MCVAGLFFIPVIG-LTGFHVVLVTRGRTT-- 217

  Fly   308 AHINEAERKRHLQQQRIYINPYNFGTKKN 336
               ||....:.    |..:||:..|...|
Mouse   218 ---NEQVTGKF----RGGVNPFTRGCYGN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 27/61 (44%)
Zdhhc8NP_001365948.1 DHHC 99..224 CDD:396215 48/184 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.