DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and ZDHHC20

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001316988.1 Gene:ZDHHC20 / 253832 HGNCID:20749 Length:365 Species:Homo sapiens


Alignment Length:371 Identity:90/371 - (24%)
Similarity:138/371 - (37%) Gaps:126/371 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WSYMKHCWHSLTFNAHMNSSYASDVCLTPIFWFVDN-----YTHCLGPFFVVGVAALTTSVVSIA 81
            |||.               :|..::|:..||...:|     |......|||:.|         .:
Human    28 WSYY---------------AYVVELCVFTIFGNEENGKTVVYLVAFHLFFVMFV---------WS 68

  Fly    82 YWIGL---------PFWWAKSQLVTYFLLIVGNWLLLNVVF--HYVMAVITPAGH--PPEGVSLV 133
            ||:.:         .|:.:.|:...|           ...|  .....::..|..  |....|..
Human    69 YWMTIFTSPASPSKEFYLSNSEKERY-----------EKEFSQERQQEILRRAARALPIYTTSAS 122

  Fly   134 EAVSMCGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNHRYFFLYMTYTTLGCLFLIL 198
            :.:..|.||...||.|.||||.|:.|||||||||||:|||||:.|:::|.|::.|:.|.|||:..
Human   123 KTIRYCEKCQLIKPDRAHHCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAA 187

  Fly   199 FGLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSGHIIPVTHPNEYDEFVLPPAVHNLPTPIVDT 263
            ..||...|:        ||                        ||                :.||
Human   188 TVLEYFIKF--------WT------------------------NE----------------LTDT 204

  Fly   264 DAASPGRRRALWFMAFTNVAVVLALGSLSIWHAKLITRGETSVEAHINEAERKRHLQQQRIYINP 328
            .|     :..:.|:.|.:....:::.||..:|..|:.:..|::|:          .:.......|
Human   205 RA-----KFHVLFLFFVSAMFFISVLSLFSYHCWLVGKNRTTIES----------FRAPTFSYGP 254

  Fly   329 ----YNFGTKKNWKLFLGLVRGRSFWRTVLLPSWHKPEGTGLSFHT 370
                ::.|..|||:...|  ..:.:|   |||.: ...|.|.||.|
Human   255 DGNGFSLGCSKNWRQVFG--DEKKYW---LLPIF-SSLGDGCSFPT 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 35/61 (57%)
ZDHHC20NP_001316988.1 zf-DHHC 16..301 CDD:327686 90/371 (24%)
Substrate binding. /evidence=ECO:0000305|PubMed:29326245 140..143 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55511
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.