DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and Zdhhc5

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_659136.1 Gene:Zdhhc5 / 228136 MGIID:1923573 Length:715 Species:Mus musculus


Alignment Length:334 Identity:79/334 - (23%)
Similarity:118/334 - (35%) Gaps:121/334 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 FVVGVA----ALTTSVVSIAYWIGLPFWWAKSQLVTYFLLIVGNWLLLNVVFHYVMAVITPAGHP 126
            |:||..    |.|...:|:.....:|.:.|     ..||.::.|         :.||.....|..
Mouse    23 FLVGATTLFFAFTCPGLSLNVSPAVPIYNA-----IMFLFVLAN---------FSMATFMDPGIF 73

  Fly   127 P----------------------EGVSLVEAVSMCGKCIAPKPPRTHHCSICNRCILKMDHHCPW 169
            |                      :|:.:  .:..|..|...:|||..|||:|:.|:.:.||||||
Mouse    74 PRAEEDEDKEDDFRAPLYKTVEIKGIQV--RMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPW 136

  Fly   170 LNNCVGYGNHRYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSGH 234
            :|||:|..|:|||||::...|...:.:..|||    .|: |.|.|               .|||.
Mouse   137 VNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGL----LYV-LYHIE---------------ELSGV 181

  Fly   235 IIPVTHPNEYDEFVLPPAVHNLPTPIVDTDAASPGRRRALWFMAFTNVA--VVLALGSLSIWHAK 297
            ...||                                     ||...||  ..:.:..|:.:|..
Mouse   182 RTAVT-------------------------------------MAVMCVAGLFFIPVAGLTGFHVV 209

  Fly   298 LITRGETSVEAHINEAERKRHLQQQRIYINPYNFGTKKNWK---------LFLGLVRGRSFWRTV 353
            |:.||.|:     ||....:.    |..:||:..|...|..         .:||  |.:.....|
Mouse   210 LVARGRTT-----NEQVTGKF----RGGVNPFTNGCCNNVSRVLCSSPAPRYLG--RPKKEKTIV 263

  Fly   354 LLPSWHKPE 362
            :.|.:.:||
Mouse   264 IRPPFLRPE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 28/61 (46%)
Zdhhc5NP_659136.1 zf-DHHC 99..224 CDD:279823 51/188 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..715
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.