DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and dhhc-5

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_498488.2 Gene:dhhc-5 / 187870 WormBaseID:WBGene00020066 Length:244 Species:Caenorhabditis elegans


Alignment Length:149 Identity:48/149 - (32%)
Similarity:69/149 - (46%) Gaps:24/149 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VVSIAYWIGLPFW-------WAKSQLVTYFLLIVGNWLLLNVVFHYVMAVITPAGHPPEGVSLVE 134
            :.:|.:.|...||       :|....::.:.|...::|.:.:|..|..|..|    ||.....||
 Worm    10 LANIGWPIAFTFWYQIIVVLYAADGTISQWALYYFHFLWIIIVCSYFSASFT----PPTKCRDVE 70

  Fly   135 AVSMCGK---------CIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNHRYFFLYMTYTT 190
            .|..|.|         |...||||.|||..||.|:.:||||||.|..|:..|||:||.|::.:. 
 Worm    71 KVEHCDKEIKEDVCQLCNYRKPPRWHHCRRCNLCVHRMDHHCPILQLCIHSGNHKYFLLFLVWP- 134

  Fly   191 LGCLFLILFGLEIGHKYLW 209
               |.|.:|.:..|:...|
 Worm   135 ---LQLAIFTIWHGYYDFW 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 30/70 (43%)
dhhc-5NP_498488.2 zf-DHHC 77..202 CDD:279823 31/78 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.