DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and dhhc-2

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_493007.2 Gene:dhhc-2 / 173062 WormBaseID:WBGene00012948 Length:404 Species:Caenorhabditis elegans


Alignment Length:177 Identity:47/177 - (26%)
Similarity:71/177 - (40%) Gaps:43/177 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GPFFVVGVAALTTSVVSIAYWIGLPFWWAKSQLVTYFLLIVGNWLLLNVVFHYVMAVITPAGHPP 127
            |.|.|..:..:.|  :::.:....||.|..|..:.    ||...|.|.|:.::.....|..|..|
 Worm    99 GAFVVTVILMIAT--LTVYFVFDAPFLWGYSPAIP----IVAAVLSLIVITNFFATSFTDPGILP 157

  Fly   128 EGVSLVEAVSM----------------------------------CGKCIAPKPPRTHHCSICNR 158
            . |..:|.:.|                                  |..|...:|||..||:||:.
 Worm   158 R-VDNIEIIEMDRQQANGNGINDVAHLRPRFQDVVVNGEHVKMKYCTTCRLYRPPRCSHCAICDN 221

  Fly   159 CILKMDHHCPWLNNCVGYGNHRYFFLYMTYTTLGCLFLILFGLEIGH 205
            |:|..||||||:.||:|..|:.||:.::  ..|..|.:.||...:.|
 Worm   222 CVLMFDHHCPWVGNCIGLRNYTYFYRFV--FCLSILVIYLFASAVTH 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 27/61 (44%)
dhhc-2NP_493007.2 zf-DHHC 72..>319 CDD:303066 47/177 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.