DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and dhhc-7

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_492960.1 Gene:dhhc-7 / 173045 WormBaseID:WBGene00007637 Length:302 Species:Caenorhabditis elegans


Alignment Length:264 Identity:67/264 - (25%)
Similarity:102/264 - (38%) Gaps:74/264 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GVAALTTSVVSIAY-------WIGLPFW----WAKSQLVTYFLLIVGNWLLLNVVFHYVMAVITP 122
            |:..:....:.|||       |:.||.:    |      |.|...|.|.||...:..:..|:::.
 Worm     8 GLVCVCMIYLLIAYADYVILIWLLLPTFGHSIW------TVFHGAVFNCLLATTIVAHTRAMLSD 66

  Fly   123 AGHPP------------------EGVSLVEAV--------------SMCGKCIAPKPPRTHHCSI 155
            .|..|                  |..|..|||              :||.:|.:.:|||.|||.:
 Worm    67 PGTVPISSSKGQNTPNPVFSSDEEDESDEEAVFRHDHLNRSSATEWTMCTRCDSLRPPRAHHCRV 131

  Fly   156 CNRCILKMDHHCPWLNNCVGYGNHRYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDH-------- 212
            |.||:.||||||||:|||||..|.::|..::.|......:.:|.   :...::|.|.        
 Worm   132 CKRCVRKMDHHCPWVNNCVGEYNQKWFLQFIFYVGASSAYSLLV---LCLCWVWHDAYGMTGIKG 193

  Fly   213 --GENWTEIEPLEGQPVKFNLSGHIIPVTHPNE-YDEFVLPPAVHNLPTPIVDTDAASPGRRRAL 274
              |||....:.:           |.|.:...:. :..|||..:...|.....|..|....:||..
 Worm   194 PLGENLYHAKVI-----------HSIMLAMESALFGLFVLAVSCDQLGAIFTDETAIESVQRRGR 247

  Fly   275 WFMA 278
            .::|
 Worm   248 NYLA 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 28/61 (46%)
dhhc-7NP_492960.1 zf-DHHC 115..240 CDD:279823 41/138 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.