Sequence 1: | NP_651539.3 | Gene: | CG5880 / 43268 | FlyBaseID: | FBgn0039489 | Length: | 381 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492960.1 | Gene: | dhhc-7 / 173045 | WormBaseID: | WBGene00007637 | Length: | 302 | Species: | Caenorhabditis elegans |
Alignment Length: | 264 | Identity: | 67/264 - (25%) |
---|---|---|---|
Similarity: | 102/264 - (38%) | Gaps: | 74/264 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 GVAALTTSVVSIAY-------WIGLPFW----WAKSQLVTYFLLIVGNWLLLNVVFHYVMAVITP 122
Fly 123 AGHPP------------------EGVSLVEAV--------------SMCGKCIAPKPPRTHHCSI 155
Fly 156 CNRCILKMDHHCPWLNNCVGYGNHRYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDH-------- 212
Fly 213 --GENWTEIEPLEGQPVKFNLSGHIIPVTHPNE-YDEFVLPPAVHNLPTPIVDTDAASPGRRRAL 274
Fly 275 WFMA 278 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5880 | NP_651539.3 | zf-DHHC | 139..>201 | CDD:279823 | 28/61 (46%) |
dhhc-7 | NP_492960.1 | zf-DHHC | 115..240 | CDD:279823 | 41/138 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1491968at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |