DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and ZDHHC19

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001034706.1 Gene:ZDHHC19 / 131540 HGNCID:20713 Length:309 Species:Homo sapiens


Alignment Length:341 Identity:77/341 - (22%)
Similarity:117/341 - (34%) Gaps:123/341 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 PFFVVGVAALTTSVVSIAYWIGLPF-----W------WAKSQLVTYFLLIVGNWLLLN----VVF 113
            |:|:..:.| ..:||.:.::.||.|     |      ||       |.:|.|:..:|.    |..
Human    23 PWFLPSLFA-AFNVVLLVFFSGLFFAFPCRWLAQNGEWA-------FPVITGSLFVLTFFSLVSL 79

  Fly   114 HYVMAVITPAGHPPEGVSLVEAV---------SMCGKCIAPKPPRTHHCSICNRCILKMDHHCPW 169
            ::....|...|...:|...|..|         ..|.||...:||||:||..||.|:...||||.|
Human    80 NFSDPGILHQGSAEQGPLTVHVVWVNHGAFRLQWCPKCCFHRPPRTYHCPWCNICVEDFDHHCKW 144

  Fly   170 LNNCVGYGNHRYFF-------LYMTYTTLGCLFLILFGLEIGHKYLWLDHGENWTEIEPLEGQPV 227
            :|||:|:.|.|:|.       ||.....:.||..                               
Human   145 VNNCIGHRNFRFFMLLVLSLCLYSGAMLVTCLIF------------------------------- 178

  Fly   228 KFNLSGHIIPVTHPNEYDEFVLPPAVHNLPTPIVDTDAASPGRRRALWFMAFTNVAVVLALGSLS 292
                   ::..||        ||.:.......:|...||.          ....::::|.:.:||
Human   179 -------LVRTTH--------LPFSTDKAIAIVVAVSAAG----------LLVPLSLLLLIQALS 218

  Fly   293 IWHAKLITRGETSVEAHINEAERKRHLQQQRIYINPYNFGTKKNWKLFLGLVRGRSFW------R 351
            :..|....:|:.            ||||.    .||::.|...||.|.:....|..:.      :
Human   219 VSSADRTYKGKC------------RHLQG----YNPFDQGCASNWYLTICAPLGPKYMAEAVQLQ 267

  Fly   352 TVLLPSW------HKP 361
            .|:.|.|      |.|
Human   268 RVVGPDWTSMPNLHPP 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 28/68 (41%)
ZDHHC19NP_001034706.1 DHHC 109..>181 CDD:366691 28/109 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..309 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.