DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and Zdhhc15

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_011245807.1 Gene:Zdhhc15 / 108672 MGIID:1915336 Length:355 Species:Mus musculus


Alignment Length:259 Identity:74/259 - (28%)
Similarity:108/259 - (41%) Gaps:84/259 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 AVSMCGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNHRYFFLYMTYTTLGCLFLILF 199
            ||..|.:|...||.|.||||:|..|:|||||||||:|||:|:.|:::|..::.|:.|.||::...
Mouse   127 AVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATT 191

  Fly   200 GLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSGHIIPVTHPNEYDEFVLPPAVHNLPTPIVDTD 264
            ......|| |  .||       |.....||    |::          |:|..|            
Mouse   192 VFSYFIKY-W--RGE-------LPSVRSKF----HVL----------FLLFVA------------ 220

  Fly   265 AASPGRRRALWFMAFTNVAVVLALGSLSIWHAKLITRGETSVEAH----INEAERKRHLQQQRIY 325
                    .::|     |::|:..|    :|..|::|.:|::||.    ......|         
Mouse   221 --------CMFF-----VSLVILFG----YHCWLVSRNKTTLEAFCTPVFTSGPEK--------- 259

  Fly   326 INPYNFGTKKNWKLFLGLVRGRSFWRTVLLPSWHKPEGTGLSFH-----------TVNDAPFED 378
             |.:|.|..||.:...|  ..:.||   |:|....| |.|.||.           ..|:.|:||
Mouse   260 -NGFNLGFIKNIQQVFG--DNKKFW---LIPIGSSP-GDGHSFPMRSMNESQNPLLANEEPWED 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 30/61 (49%)
Zdhhc15XP_011245807.1 DHHC <126..308 CDD:388695 70/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55511
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.