DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5880 and zdhhc9

DIOPT Version :9

Sequence 1:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001096162.1 Gene:zdhhc9 / 100124706 XenbaseID:XB-GENE-1016830 Length:365 Species:Xenopus tropicalis


Alignment Length:218 Identity:56/218 - (25%)
Similarity:90/218 - (41%) Gaps:64/218 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 PAG-HPPEGVSLVE------AVSMCGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNH 179
            |.| .||..:..|:      .:..|..|...:|||..|||||:.|:.:.||||||:.||||..|:
 Frog   117 PQGQRPPPRIKNVQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNY 181

  Fly   180 RYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSGHIIPVTHPNEY 244
            |||:|::...:|..:::..|                                  :|:.|      
 Frog   182 RYFYLFILSLSLLTIYIFAF----------------------------------NIVYV------ 206

  Fly   245 DEFVLPPAVHNLPTPIVDTDAASPGRRRALWFMAFTNVAVVLALGSLSIWHAKLITRGETSVEAH 309
                   |:::|....::|...|||....::...||..:||    .|:.:|..|::..:|:.|..
 Frog   207 -------ALNSLSIGFLNTLKESPGTVLEVFICFFTLWSVV----GLTGFHTFLVSLNQTTNEDI 260

  Fly   310 INEAERKRHLQQQRIYINPYNFG 332
            ......|..:|      |||:.|
 Frog   261 KGSWTGKNRVQ------NPYSHG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 28/61 (46%)
zdhhc9NP_001096162.1 DHHC 138..261 CDD:366691 45/173 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.