DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5815 and AT4G37860

DIOPT Version :9

Sequence 1:NP_733196.1 Gene:CG5815 / 43266 FlyBaseID:FBgn0027574 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_195499.1 Gene:AT4G37860 / 829942 AraportID:AT4G37860 Length:354 Species:Arabidopsis thaliana


Alignment Length:428 Identity:94/428 - (21%)
Similarity:162/428 - (37%) Gaps:129/428 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 KERVKAAITREREEAKGNTRQKSSTSTLPSSATKSKESSVARSYSTSKTLYDPN----AEKLEEE 225
            ::|:|.:|..:        .|...|...|:|.|:..:|.....|... :.:.|:    |.::.:|
plant     9 RQRIKESIRTK--------MQSGDTIIAPTSQTQLHQSKSNLPYDFG-SFFGPSQTVIASRVLQE 64

  Fly   226 RKKRQEEEQRRAKIKRPAQPPPMDFQALLRLAEKKQHEPVVFEVEKKKEPERLLSAREKRELEER 290
            .|...|.|...||:....|.     ..|:|...      ..|...:||....:..|...:...|.
plant    65 SKPLLENETSAAKMLNSIQN-----VCLIRSFF------FTFLTLQKKSSVLMNDASGTKNANEV 118

  Fly   291 QRQQEQRAQRLK------MRESEGKETPKSIPNRMEPNGRIPKLNQAKPANAPSDSFKKPTAPQP 349
            :|    :|::||      ...|:..:.|.||   .||           |.:.|| |.:....|:|
plant   119 KR----KAEKLKDGRDYSFLFSDDAQLPVSI---KEP-----------PTSRPS-STESQMQPRP 164

  Fly   350 TKSSASSTSLSSSNSHSSASRSSVSSSRPATKSAQLTARPGATASAVGKPSSSSSRDVPSKNPYA 414
            ..|:.........::.:|..|.|::..                    |:|||.    :..:.|.:
plant   165 GSSNNVQAHTREDSAINSQKRKSMNKK--------------------GQPSSK----LGHQRPLS 205

  Fly   415 ATSLKGTVREFPPRDQSSISTLDRRKIPAAAKTRQTPSSDVQRSQGGRQFPPADVKRRKPNEPP- 478
            :|.        |.|..|....:::|.:          |.::.||    |.|||  |.:..::|| 
plant   206 STK--------PLRHDSKQQRVEQRNV----------SLELTRS----QLPPA--KHQLISKPPL 246

  Fly   479 --VTKR--RIYDDDDEDEYDSELDDFIDDGDCEEDISSHIRDIFGYDKRRYQGIDD--DDRGMES 537
              |.|:  ::.:||...:...::        |:.|              |:.|.|:  |||.||:
plant   247 KRVKKKPVKMSEDDLALQMVRKM--------CKTD--------------RFAGRDEDYDDRCMEA 289

  Fly   538 SFAQVQREEFISKKLGMQEDLEDMRM---EAAHKKQKK 572
            :|..:.|||..|::|..:||.|.:|:   |...::|||
plant   290 NFDDIMREEKRSERLAKKEDAEQLRLVEEEERVRRQKK 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5815NP_733196.1 SPT2 <500..573 CDD:285455 24/78 (31%)
AT4G37860NP_195499.1 SPT2 242..329 CDD:214818 30/108 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22691
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.