DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and ACA7

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_172287.1 Gene:ACA7 / 837326 AraportID:AT1G08080 Length:275 Species:Arabidopsis thaliana


Alignment Length:294 Identity:82/294 - (27%)
Similarity:129/294 - (43%) Gaps:66/294 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FLLICWSQAVSSH-------VFGYSEPNQR---RWAR---HHGHCA-GKTQSPIAITTSRTTAI- 60
            |.::..|.|.|||       .|.|.:.:::   ||..   ....|. |:.||||.:...|...: 
plant    19 FTIVSISSAASSHGEVEDEREFNYKKNDEKGPERWGELKPEWEMCGKGEMQSPIDLMNERVNIVS 83

  Fly    61 HMPAVDMIGYHNLLPYPLKMINNGHTVSITIPKVNVTEVGEDFLPYIRGA---KLPG-EFEVEGL 121
            |:..::    .:..|....:.|.||.:.:..         ||      ||   |:.| |:|::.|
plant    84 HLGRLN----RDYNPSNATLKNRGHDIMLKF---------ED------GAGTIKINGFEYELQQL 129

  Fly   122 HFHWGDKNNRGSEHVINDIRYTMEMHIVH--RNKKYATIGEALNHPDGAAVLGFFFNLDEDEGAG 184
            |:|      ..|||.||..|:.:|:|:||  ||::.|.:  .:.:..|.|            ...
plant   130 HWH------SPSEHTINGRRFALELHMVHEGRNRRMAVV--TVLYKIGRA------------DTF 174

  Fly   185 LVTINRHLHLIADANQEATLNVTFSLSSLIAGVDVDKFYTYKGSLTTPPCSEAVTWILFPDPIPI 249
            :.::.:.|..||:. :||..||.....:.|. :...|:|.|.||||||||::.|||.:......:
plant   175 IRSLEKELEGIAEM-EEAEKNVGMIDPTKIK-IGSRKYYRYTGSLTTPPCTQNVTWSVVRKVRTV 237

  Fly   250 SPKQISRFRQLSDTQDGALVDNFRTLQPVGNRRI 283
            :.||:...|..  ..|.| ..|.|.:||. |:||
plant   238 TRKQVKLLRVA--VHDDA-NSNARPVQPT-NKRI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 74/270 (27%)
ACA7NP_172287.1 alpha_CA_prokaryotic_like 49..270 CDD:239398 74/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.