DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and ACA3

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_196038.1 Gene:ACA3 / 830296 AraportID:AT5G04180 Length:277 Species:Arabidopsis thaliana


Alignment Length:241 Identity:67/241 - (27%)
Similarity:108/241 - (44%) Gaps:36/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GKTQSPIAITTSRTTAIHMPAVDMIGYHNLLPYPLKMINNGHTVSITIPKVNVTEVGEDFLPYIR 108
            ||.||||.:|......:|.....:..|:..:...||  |.|..:.:.         .||    ..
plant    52 GKRQSPINLTPKIARIVHNSTEILQTYYKPVEAILK--NRGFDMKVK---------WED----DA 101

  Fly   109 GAKLPGEFEVEGLHFHWGDKNNRGSEHVINDIRYTMEMHIVHRNKKYATIGEALNHPDGAAVLGF 173
            |..:..:.:.:.:..||    :..|||.::..|..||:|:||::.:        .|   .||:|.
plant   102 GKIVINDTDYKLVQSHW----HAPSEHFLDGQRLAMELHMVHKSVE--------GH---LAVIGV 151

  Fly   174 FFNLDEDEGAGLVTINRHLHLIADANQEATLNVTFSLSSLIAGVDVDKFYTYKGSLTTPPCSEAV 238
            .|. :.:..|.:..|...:|.|||. |:..:::. .:.....|.|:.|||.|:||||||||:|.|
plant   152 LFR-EGEPNAFISRIMDKIHKIADV-QDGEVSIG-KIDPREFGWDLTKFYEYRGSLTTPPCTEDV 213

  Fly   239 TWILFPDPIPISPKQISRFRQLSDTQDGALVDNFRTLQPVGNRRIF 284
            .|.:......:|.:||.   .|:|.:.|....|.|..||:..|.::
plant   214 MWTIINKVGTVSREQID---VLTDARRGGYEKNARPAQPLNGRLVY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 66/237 (28%)
ACA3NP_196038.1 alpha_CA_prokaryotic_like 35..257 CDD:239398 67/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.