DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and ACA2

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001318303.1 Gene:ACA2 / 817367 AraportID:AT2G28210 Length:276 Species:Arabidopsis thaliana


Alignment Length:310 Identity:83/310 - (26%)
Similarity:122/310 - (39%) Gaps:85/310 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTAFLEASFLLICWSQAV------SSHVFGYSEPNQR----RWARHHGH---CA-GKTQSPIAIT 53
            ||:|:..   :.|.|.|.      ..|.|.| |.||.    :|.:....   |. |:.||||.:.
plant    14 LTSFVTT---VSCLSAATDYREVEDEHEFSY-EWNQENGPAKWGKLRPEWKMCGKGEMQSPIDLM 74

  Fly    54 TSRTTAI-HMPAVDMIGYHNLLPYPLKMINNGHTVSITIPKVNVTEVGEDFLPYIRGAKLPGEFE 117
            ..|...: |:..:.    .:..|....:.|.||.:.:        :.||:      |:   |...
plant    75 NKRVRLVTHLKKLT----RHYKPCNATLKNRGHDMML--------KFGEE------GS---GSIT 118

  Fly   118 VEG-----LHFHWGDKNNRGSEHVINDIRYTMEMHIVHRN----KKYATIGEALNHPDGAAVLGF 173
            |.|     |..||    :..|||.:|..|:.:|:|:||.|    ....|:...:..||.      
plant   119 VNGTEYKLLQLHW----HSPSEHTMNGRRFALELHMVHENINGSLAVVTVLYKIGRPDS------ 173

  Fly   174 FFNLDEDEGAGLVTINRHLHLIADANQEATLNVTFSLSSLIAGVDVD----KFYTYKGSLTTPPC 234
            |..|.|::          |..|.|.| ||...|     .:|...|:.    |||.|.||||||||
plant   174 FLGLLENK----------LSAITDQN-EAEKYV-----DVIDPRDIKIGSRKFYRYIGSLTTPPC 222

  Fly   235 SEAVTWILFPDPIPISPKQISRFR-QLSDTQDGALVDNFRTLQPVGNRRI 283
            ::.|.|.:......::..|:...| .:.|..|    .|.|.:||. |:|:
plant   223 TQNVIWTVVKKVRTVTKNQVKLLRVAVHDNSD----TNARPVQPT-NKRV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 75/279 (27%)
ACA2NP_001318303.1 alpha_CA_prokaryotic_like 48..270 CDD:239398 71/272 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.